Carrinho de compras
| Load Time | 159.454 ms |
| Querying Time | 64 ms |
| Queries | 237 |
| Memory Peak Usage | 11.7 Mb |
| Included Files | 1209 files - 14.66 Mb |
| PrestaShop Cache | - Mb |
| Global vars | 0.26 Mb |
| PrestaShop Version | 8.2.1 |
| PHP Version | 8.1.33 |
| MySQL Version | 11.4.8-MariaDB-ubu2404-log |
| Memory Limit | 512M |
| Max Execution Time | 180s |
| Smarty Cache | enabled |
| Smarty Compilation | never recompile |
| Time | Cumulated Time | Memory Usage | Memory Peak Usage | |
|---|---|---|---|---|
| config | 11.214 ms | 11.214 ms | 3.27 Mb | 3.6 Mb |
| __construct | 0.013 ms | 11.227 ms | - Mb | 3.6 Mb |
| init | 8.822 ms | 20.049 ms | 0.46 Mb | 4.0 Mb |
| checkAccess | 0.001 ms | 20.050 ms | - Mb | 4.0 Mb |
| setMedia | 2.849 ms | 22.899 ms | 0.08 Mb | 4.0 Mb |
| postProcess | 0.001 ms | 22.900 ms | - Mb | 4.0 Mb |
| initHeader | 0.002 ms | 22.902 ms | - Mb | 4.0 Mb |
| initContent | 69.950 ms | 92.852 ms | 3.50 Mb | 7.3 Mb |
| initFooter | 0.002 ms | 92.854 ms | - Mb | 7.3 Mb |
| display | 66.600 ms | 159.454 ms | 3.48 Mb | 11.7 Mb |
| Module | Time | Memory Usage |
|---|---|---|
| ph_simpleblog | 3.834 ms | 0.02 Mb |
| revi | 4.472 ms | 0.41 Mb |
| cookiesplus | 6.607 ms | 0.20 Mb |
| ets_superspeed | 9.257 ms | 0.10 Mb |
| ps_mbo | 5.140 ms | 0.06 Mb |
| iqitthemeeditor | 0.953 ms | 0.09 Mb |
| ps_emailsubscription | 0.406 ms | 0.01 Mb |
| ps_socialfollow | 0.229 ms | 0.01 Mb |
| ps_emailalerts | 0.196 ms | 0.01 Mb |
| revsliderprestashop | 1.847 ms | 0.03 Mb |
| ps_shoppingcart | 0.152 ms | 0.01 Mb |
| ps_searchbar | 0.594 ms | 0.01 Mb |
| productcomments | 12.906 ms | 0.39 Mb |
| ps_googleanalytics | 1.650 ms | 0.06 Mb |
| iqitcontactpage | 1.167 ms | 0.07 Mb |
| iqitcountdown | 0.335 ms | 0.01 Mb |
| iqitelementor | 3.292 ms | 0.16 Mb |
| iqitfreedeliverycount | 0.158 ms | 0.01 Mb |
| iqitmegamenu | 1.536 ms | 0.33 Mb |
| iqitreviews | 0.354 ms | 0.01 Mb |
| iqitsizecharts | 0.291 ms | 0.01 Mb |
| iqitwishlist | 4.945 ms | 0.24 Mb |
| iqitextendedproduct | 0.365 ms | 0.01 Mb |
| iqitsociallogin | 1.068 ms | 0.08 Mb |
| stripe_official | 1.269 ms | 0.06 Mb |
| amazzingfilter | 1.687 ms | 0.05 Mb |
| cdc_googletagmanager | 1.502 ms | 0.07 Mb |
| iqitlinksmanager | 1.669 ms | 0.12 Mb |
| iqithtmlandbanners | 1.233 ms | 0.08 Mb |
| iqitsearch | 1.098 ms | 0.07 Mb |
| ps_customersignin | 0.097 ms | 0.01 Mb |
| iqitproductsnav | 0.571 ms | 0.05 Mb |
| statsdata | 1.245 ms | 0.12 Mb |
| 33 module(s) | 72.124 ms | 2.95 Mb |
| # | Query | Time (ms) | Rows | Filesort | Group By | Location |
|---|---|---|---|---|---|---|
| 2 | SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop FROM `ps_configuration` c LEFT JOIN `ps_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`) |
2.108 ms | 3436 | /classes/Configuration.php:180 | ||
| 66 | SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, IFNULL(product_attribute_shop.`id_product_attribute`,0) id_product_attribute
, pl.`description`, pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`,
pl.`meta_title`, pl.`name`, pl.`available_now`, pl.`available_later`, image_shop.`id_image` id_image, il.`legend`, m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
"2025-11-02 00:00:00",
INTERVAL 0 DAY
)
) > 0 AS new FROM `ps_product` p
INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)LEFT JOIN `ps_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN `ps_product_lang` pl
ON (p.`id_product` = pl.`id_product` AND pl.`id_lang` = 2 AND pl.id_shop = 1 )
LEFT JOIN `ps_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `ps_image_lang` il
ON (image_shop.`id_image` = il.`id_image` AND il.`id_lang` = 2)
LEFT JOIN `ps_manufacturer` m
ON (m.`id_manufacturer` = p.`id_manufacturer`)
LEFT JOIN ps_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1 AND stock.id_shop_group = 0 )JOIN `ps_category_product` cp ON (p.id_product = cp.id_product)JOIN `ps_category_group` cg ON (cp.`id_category` = cg.`id_category` AND cg.`id_group` =1)JOIN `ps_category` ca ON cp.`id_category` = ca.`id_category` AND ca.`active` = 1
WHERE p.`id_manufacturer` = 608
AND product_shop.`active` = 1
AND product_shop.`visibility` IN ("both", "catalog")
GROUP BY p.id_product
ORDER BY pl.`name` asc
LIMIT 0,99999 |
1.763 ms | 24 | Yes | Yes | /classes/Manufacturer.php:499 |
| 14 | SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module FROM `ps_module` m INNER JOIN ps_module_shop module_shop ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1) INNER JOIN `ps_hook_module` `hm` ON hm.`id_module` = m.`id_module` INNER JOIN `ps_hook` `h` ON hm.`id_hook` = h.`id_hook` LEFT JOIN `ps_module_group` `mg` ON mg.`id_module` = m.`id_module` WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND mg.`id_group` IN (1)) GROUP BY hm.id_hook, hm.id_module ORDER BY hm.`position` |
1.602 ms | 465 | Yes | Yes | /classes/Hook.php:1289 |
| 74 | SELECT SQL_NO_CACHE `id_hook`, `name` FROM `ps_hook` UNION SELECT `id_hook`, ha.`alias` as name FROM `ps_hook_alias` ha INNER JOIN `ps_hook` h ON ha.name = h.name |
1.369 ms | 0 | /classes/Hook.php:1348 | ||
| 75 | SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active FROM `ps_hook_module` hm STRAIGHT_JOIN `ps_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1) STRAIGHT_JOIN `ps_module` as m ON (m.id_module = hm.id_module) ORDER BY hm.position |
1.237 ms | 568 | /classes/Hook.php:459 | ||
| 16 | SELECT SQL_NO_CACHE `id_hook`, `name` FROM `ps_hook` |
0.847 ms | 1067 | /classes/Hook.php:1348 | ||
| 64 | SELECT SQL_NO_CACHE t.id_template, t.template_filters AS filters, t.additional_settings, tl.data AS lang FROM ps_af_templates t LEFT JOIN ps_af_templates_lang tl ON tl.id_template = t.id_template AND tl.id_shop = t.id_shop AND tl.id_lang = 2 INNER JOIN `ps_af_manufacturer_templates` ct ON ct.id_template = t.id_template AND ct.id_shop = t.id_shop AND ct.`id_manufacturer` IN (608, 0) WHERE t.active = 1 AND t.template_controller = 'manufacturer' AND t.id_shop = 1 ORDER BY ct.`id_manufacturer` DESC, t.id_template DESC LIMIT 1 |
0.727 ms | 1 | Yes | /modules/amazzingfilter/amazzingfilter.php:3723 | |
| 233 | SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `ps_category_product` cp LEFT JOIN `ps_category` c ON (c.id_category = cp.id_category) LEFT JOIN `ps_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 ) INNER JOIN ps_category_shop category_shop ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) WHERE cp.`id_product` IN (9664,10353,10354,12589,12590,12592,12593,12591) AND cl.`id_lang` = 2 ORDER BY c.`level_depth` DESC |
0.716 ms | 52 | Yes | /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109 | |
| 13 | SELECT SQL_NO_CACHE lower(name) as name FROM `ps_hook` h WHERE (h.active = 1) |
0.692 ms | 1067 | /classes/Hook.php:1388 | ||
| 187 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12590) AND (b.`id_shop` = 1) LIMIT 1 |
0.674 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 213 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN ps_stock_available stock ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 ) JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2) JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (9664) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` HAVING qty > 0 ORDER BY a.`position` ASC; |
0.616 ms | 1 | Yes | /classes/Product.php:4524 | |
| 236 | SELECT SQL_NO_CACHE id_cache_page FROM `ps_ets_superspeed_cache_page` WHERE page="manufacturer" AND id_lang="2" AND id_country = "6" AND id_currency = "1" AND id_shop="1" AND user_agent="Desktop" AND date_add > "2025-11-02 17:06:58"AND id_object="608" AND has_customer=0 AND has_cart=0 LIMIT 1 |
0.572 ms | 6 | /modules/ets_superspeed/classes/cache.php:234 | ||
| 76 | SELECT SQL_NO_CACHE tr.*
FROM `ps_tax_rule` tr
JOIN `ps_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.538 ms | 1 | /classes/tax/TaxRulesTaxManager.php:109 | ||
| 215 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN ps_stock_available stock ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 ) JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2) JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (10353) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` HAVING qty > 0 ORDER BY a.`position` ASC; |
0.532 ms | 1 | Yes | /classes/Product.php:4524 | |
| 157 | SELECT SQL_NO_CACHE p.*, ps.*, pl.*, sa.out_of_stock, IFNULL(sa.quantity, 0) as quantity, (DATEDIFF( p.`date_add`, DATE_SUB( '2025-11-02 00:00:00', INTERVAL 0 DAY ) ) > 0) as new FROM ps_product p LEFT JOIN ps_product_lang pl ON pl.id_product = p.id_product AND pl.id_shop = 1 AND pl.id_lang = 2 LEFT JOIN ps_stock_available sa ON sa.id_product = p.id_product AND sa.id_product_attribute = 0 AND sa.id_shop = 1 LEFT JOIN ps_product_shop ps ON ps.id_product = p.id_product AND ps.id_shop = 1 WHERE p.id_product IN (9664,10353,10354,12589,12590,12592,12593,12591) |
0.520 ms | 8 | /classes/ProductAssembler.php:95 | ||
| 217 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN ps_stock_available stock ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 ) JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2) JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (10354) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` HAVING qty > 0 ORDER BY a.`position` ASC; |
0.486 ms | 1 | Yes | /classes/Product.php:4524 | |
| 65 | SELECT SQL_NO_CACHE t.id_template, t.template_filters AS filters, t.additional_settings, tl.data AS lang FROM ps_af_templates t LEFT JOIN ps_af_templates_lang tl ON tl.id_template = t.id_template AND tl.id_shop = t.id_shop AND tl.id_lang = 2 INNER JOIN `ps_af_manufacturer_templates` ct ON ct.id_template = t.id_template AND ct.id_shop = t.id_shop AND ct.`id_manufacturer` IN (608, 0) WHERE t.active = 1 AND t.template_controller = 'manufacturer' AND t.id_shop = 1 ORDER BY ct.`id_manufacturer` DESC, t.id_template DESC LIMIT 1 |
0.484 ms | 1 | Yes | /modules/amazzingfilter/amazzingfilter.php:3723 | |
| 223 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN ps_stock_available stock ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 ) JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2) JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (12592) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` HAVING qty > 0 ORDER BY a.`position` ASC; |
0.483 ms | 1 | Yes | /classes/Product.php:4524 | |
| 219 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN ps_stock_available stock ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 ) JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2) JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (12589) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` HAVING qty > 0 ORDER BY a.`position` ASC; |
0.480 ms | 1 | Yes | /classes/Product.php:4524 | |
| 227 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN ps_stock_available stock ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 ) JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2) JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (12591) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` HAVING qty > 0 ORDER BY a.`position` ASC; |
0.470 ms | 1 | Yes | /classes/Product.php:4524 | |
| 221 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN ps_stock_available stock ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 ) JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2) JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (12590) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` HAVING qty > 0 ORDER BY a.`position` ASC; |
0.470 ms | 1 | Yes | /classes/Product.php:4524 | |
| 225 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `ps_product_attribute` pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN ps_stock_available stock ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1 AND stock.id_shop_group = 0 ) JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2) JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (12593) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` HAVING qty > 0 ORDER BY a.`position` ASC; |
0.469 ms | 1 | Yes | /classes/Product.php:4524 | |
| 83 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `ps_cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 9664 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 9664 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.428 ms | 0 | /classes/Cart.php:1430 | ||
| 94 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `ps_cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 10353 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 10353 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.426 ms | 0 | /classes/Cart.php:1430 | ||
| 188 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12592) AND (b.`id_shop` = 1) LIMIT 1 |
0.422 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 34 | SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop` FROM `ps_module` m LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module` AND ms.`id_shop` = 1 |
0.417 ms | 110 | /classes/module/Module.php:346 | ||
| 135 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `ps_cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 12592 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 12592 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.408 ms | 0 | /classes/Cart.php:1430 | ||
| 84 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM ps_feature_product pf LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2) LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2) LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2) INNER JOIN ps_feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 9664 ORDER BY f.position ASC |
0.401 ms | 1 | Yes | /classes/Product.php:6021 | |
| 229 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1 |
0.400 ms | 1 | /classes/module/Module.php:2137 | ||
| 22 | SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang FROM `ps_meta` m LEFT JOIN `ps_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 ) ORDER BY LENGTH(ml.url_rewrite) DESC |
0.394 ms | 124 | Yes | /classes/Dispatcher.php:654 | |
| 156 | SELECT SQL_NO_CACHE p.`id_product`
FROM `ps_product` p
INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_manufacturer = 608 AND product_shop.`active` = 1
AND product_shop.`visibility` IN ("both", "catalog")
AND EXISTS (
SELECT 1
FROM `ps_category_group` cg
LEFT JOIN `ps_category_product` cp ON (cp.`id_category` = cg.`id_category`) INNER JOIN `ps_category` ca ON cp.`id_category` = ca.`id_category` AND ca.`active` = 1
WHERE p.`id_product` = cp.`id_product` AND cg.`id_group` =1
) |
0.391 ms | 24 | /classes/Manufacturer.php:430 | ||
| 0 | SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main FROM ps_shop_url su LEFT JOIN ps_shop s ON (s.id_shop = su.id_shop) WHERE (su.domain = 'industrialerotica.com' OR su.domain_ssl = 'industrialerotica.com') AND s.active = 1 AND s.deleted = 0 ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC |
0.390 ms | 1 | Yes | /classes/shop/Shop.php:1364 | |
| 190 | SELECT SQL_NO_CACHE 1 FROM `ps_cart_rule` WHERE ((date_to >= "2025-11-02 00:00:00" AND date_to <= "2025-11-02 23:59:59") OR (date_from >= "2025-11-02 00:00:00" AND date_from <= "2025-11-02 23:59:59") OR (date_from < "2025-11-02 00:00:00" AND date_to > "2025-11-02 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1 |
0.386 ms | 1 | /classes/CartRule.php:357 | ||
| 189 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12593) AND (b.`id_shop` = 1) LIMIT 1 |
0.384 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 105 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `ps_cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 10354 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 10354 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.384 ms | 0 | /classes/Cart.php:1430 | ||
| 186 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12589) AND (b.`id_shop` = 1) LIMIT 1 |
0.374 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 125 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `ps_cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 12590 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 12590 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.358 ms | 0 | /classes/Cart.php:1430 | ||
| 145 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `ps_cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 12593 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 12593 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.355 ms | 0 | /classes/Cart.php:1430 | ||
| 115 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `ps_cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 12589 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 12589 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.354 ms | 0 | /classes/Cart.php:1430 | ||
| 235 | INSERT INTO `ps_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('50289', '', 'industrialerotica.com/pt/marcas/anbiguo-608?resultsPerPage=99999', '', '2025-11-02 17:21:58') |
0.353 ms | 1 | /classes/ObjectModel.php:622 | ||
| 39 | SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop` FROM `ps_module` m LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module` AND ms.`id_shop` = 1 |
0.337 ms | 110 | /classes/module/Module.php:346 | ||
| 20 | SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop` FROM `ps_module` m LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module` AND ms.`id_shop` = 1 |
0.332 ms | 110 | /classes/module/Module.php:346 | ||
| 21 | SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop` FROM `ps_module` m LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module` AND ms.`id_shop` = 1 |
0.331 ms | 110 | /classes/module/Module.php:346 | ||
| 89 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 10353) AND (b.`id_shop` = 1) LIMIT 1 |
0.324 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 126 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM ps_feature_product pf LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2) LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2) LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2) INNER JOIN ps_feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 12590 ORDER BY f.position ASC |
0.324 ms | 1 | Yes | /classes/Product.php:6021 | |
| 165 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 10353) AND (b.`id_shop` = 1) LIMIT 1 |
0.321 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 130 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12592) AND (b.`id_shop` = 1) LIMIT 1 |
0.320 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 18 | SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop` FROM `ps_module` m LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module` AND ms.`id_shop` = 1 |
0.316 ms | 110 | /classes/module/Module.php:346 | ||
| 163 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 10353) AND (b.`id_shop` = 1) LIMIT 1 |
0.316 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 154 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `ps_cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 12591 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 12591 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.313 ms | 0 | /classes/Cart.php:1430 | ||
| 136 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM ps_feature_product pf LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2) LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2) LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2) INNER JOIN ps_feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 12592 ORDER BY f.position ASC |
0.309 ms | 1 | Yes | /classes/Product.php:6021 | |
| 1 | SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri FROM ps_shop_group gs LEFT JOIN ps_shop s ON s.id_shop_group = gs.id_shop_group LEFT JOIN ps_shop_url su ON s.id_shop = su.id_shop AND su.main = 1 WHERE s.deleted = 0 AND gs.deleted = 0 ORDER BY gs.name, s.name |
0.303 ms | 1 | Yes | /classes/shop/Shop.php:715 | |
| 50 | SELECT SQL_NO_CACHE * FROM ps_cookiesplus_finality cf LEFT JOIN ps_cookiesplus_finality_lang cfl on cf.`id_cookiesplus_finality` = cfl.`id_cookiesplus_finality` WHERE cfl.`id_lang` = 2 AND cf.`active` = 1 AND cf.`id_shop` = 1 ORDER BY `position`; |
0.302 ms | 4 | Yes | /modules/cookiesplus/classes/CookiesPlusFinality.php:98 | |
| 100 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 10354) AND (b.`id_shop` = 1) LIMIT 1 |
0.298 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 183 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 9664) AND (b.`id_shop` = 1) LIMIT 1 |
0.294 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 29 | SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop` FROM `ps_module` m LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module` AND ms.`id_shop` = 1 |
0.293 ms | 110 | /classes/module/Module.php:346 | ||
| 191 | SELECT SQL_NO_CACHE 1 FROM `ps_cart_rule` WHERE ((date_to >= "2025-11-02 00:00:00" AND date_to <= "2025-11-02 23:59:59") OR (date_from >= "2025-11-02 00:00:00" AND date_from <= "2025-11-02 23:59:59") OR (date_from < "2025-11-02 00:00:00" AND date_to > "2025-11-02 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1 |
0.293 ms | 1 | /classes/CartRule.php:357 | ||
| 158 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 9664) AND (b.`id_shop` = 1) LIMIT 1 |
0.291 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 160 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 9664) AND (b.`id_shop` = 1) LIMIT 1 |
0.291 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 95 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM ps_feature_product pf LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2) LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2) LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2) INNER JOIN ps_feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 10353 ORDER BY f.position ASC |
0.289 ms | 1 | Yes | /classes/Product.php:6021 | |
| 106 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM ps_feature_product pf LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2) LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2) LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2) INNER JOIN ps_feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 10354 ORDER BY f.position ASC |
0.288 ms | 1 | Yes | /classes/Product.php:6021 | |
| 180 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12593) AND (b.`id_shop` = 1) LIMIT 1 |
0.286 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 120 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12590) AND (b.`id_shop` = 1) LIMIT 1 |
0.275 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 131 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `ps_product` p INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 12592) |
0.273 ms | 1 | /classes/Product.php:3860 | ||
| 184 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 10353) AND (b.`id_shop` = 1) LIMIT 1 |
0.270 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 138 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 12593 AND image_shop.`cover` = 1 LIMIT 1 |
0.269 ms | 6 | /classes/Product.php:3570 | ||
| 110 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12589) AND (b.`id_shop` = 1) LIMIT 1 |
0.267 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 149 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12591) AND (b.`id_shop` = 1) LIMIT 1 |
0.267 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 128 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 12592 AND image_shop.`cover` = 1 LIMIT 1 |
0.265 ms | 6 | /classes/Product.php:3570 | ||
| 53 | SELECT SQL_NO_CACHE cc.name FROM ps_cookiesplus_cookie cc LEFT JOIN ps_cookiesplus_cookie_lang ccl on cc.`id_cookiesplus_cookie` = ccl.`id_cookiesplus_cookie` WHERE `id_cookiesplus_finality` = 4 AND ccl.`id_lang` = 2 AND cc.`active` = 1 AND cc.`id_shop` = 1 ORDER BY cc.`name`; |
0.264 ms | 66 | Yes | /modules/cookiesplus/classes/CookiesPlusCookie.php:118 | |
| 166 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 10354) AND (b.`id_shop` = 1) LIMIT 1 |
0.264 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 155 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM ps_feature_product pf LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2) LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2) LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2) INNER JOIN ps_feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 12591 ORDER BY f.position ASC |
0.263 ms | 1 | Yes | /classes/Product.php:6021 | |
| 90 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `ps_product` p INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 10353) |
0.262 ms | 1 | /classes/Product.php:3860 | ||
| 181 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2) WHERE i.`id_product` = 12591 ORDER BY `position` |
0.261 ms | 6 | Yes | /classes/Product.php:3545 | |
| 169 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12589) AND (b.`id_shop` = 1) LIMIT 1 |
0.259 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 192 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitelementor" LIMIT 1 |
0.258 ms | 1 | /classes/module/Module.php:2664 | ||
| 116 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM ps_feature_product pf LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2) LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2) LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2) INNER JOIN ps_feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 12589 ORDER BY f.position ASC |
0.257 ms | 1 | Yes | /classes/Product.php:6021 | |
| 164 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2) WHERE i.`id_product` = 0 ORDER BY `position` |
0.257 ms | 1 | Yes | /classes/Product.php:3545 | |
| 140 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12593) AND (b.`id_shop` = 1) LIMIT 1 |
0.256 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 174 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12590) AND (b.`id_shop` = 1) LIMIT 1 |
0.255 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 146 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM ps_feature_product pf LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2) LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2) LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2) INNER JOIN ps_feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 12593 ORDER BY f.position ASC |
0.255 ms | 1 | Yes | /classes/Product.php:6021 | |
| 108 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 12589 AND image_shop.`cover` = 1 LIMIT 1 |
0.254 ms | 6 | /classes/Product.php:3570 | ||
| 234 | SELECT SQL_NO_CACHE `id_guest` FROM `ps_connections` WHERE `id_guest` = 50456 AND `date_add` > '2025-11-02 16:51:00' AND id_shop IN (1) ORDER BY `date_add` DESC LIMIT 1 |
0.253 ms | 1 | Yes | /classes/Connection.php:168 | |
| 171 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12589) AND (b.`id_shop` = 1) LIMIT 1 |
0.251 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 71 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 9664) AND (b.`id_shop` = 1) LIMIT 1 |
0.251 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 51 | SELECT SQL_NO_CACHE cc.name FROM ps_cookiesplus_cookie cc LEFT JOIN ps_cookiesplus_cookie_lang ccl on cc.`id_cookiesplus_cookie` = ccl.`id_cookiesplus_cookie` WHERE `id_cookiesplus_finality` = 1 AND ccl.`id_lang` = 2 AND cc.`active` = 1 AND cc.`id_shop` = 1 ORDER BY cc.`name`; |
0.250 ms | 66 | Yes | /modules/cookiesplus/classes/CookiesPlusCookie.php:118 | |
| 17 | SELECT SQL_NO_CACHE value FROM `ps_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1 |
0.248 ms | 1 | /classes/shop/Shop.php:1183 | ||
| 185 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 10354) AND (b.`id_shop` = 1) LIMIT 1 |
0.247 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 172 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12590) AND (b.`id_shop` = 1) LIMIT 1 |
0.246 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 118 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 12590 AND image_shop.`cover` = 1 LIMIT 1 |
0.243 ms | 6 | /classes/Product.php:3570 | ||
| 101 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `ps_product` p INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 10354) |
0.241 ms | 1 | /classes/Product.php:3860 | ||
| 137 | SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute FROM ps_product_attribute pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE pa.id_product = 12593 LIMIT 1 |
0.240 ms | 1 | /classes/Product.php:1106 | ||
| 168 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 10354) AND (b.`id_shop` = 1) LIMIT 1 |
0.239 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 175 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12592) AND (b.`id_shop` = 1) LIMIT 1 |
0.239 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 11 | SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `ps_lang` l JOIN ps_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1) WHERE l.`active` = 1 LIMIT 1 |
0.238 ms | 2 | /classes/Language.php:1216 | ||
| 111 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `ps_product` p INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 12589) |
0.237 ms | 1 | /classes/Product.php:3860 | ||
| 178 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12593) AND (b.`id_shop` = 1) LIMIT 1 |
0.235 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 97 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 10354 AND image_shop.`cover` = 1 LIMIT 1 |
0.235 ms | 6 | /classes/Product.php:3570 | ||
| 159 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2) WHERE i.`id_product` = 0 ORDER BY `position` |
0.232 ms | 1 | Yes | /classes/Product.php:3545 | |
| 230 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitsociallogin" LIMIT 1 |
0.232 ms | 1 | /classes/module/Module.php:2664 | ||
| 86 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 10353 AND image_shop.`cover` = 1 LIMIT 1 |
0.231 ms | 6 | /classes/Product.php:3570 | ||
| 177 | SELECT SQL_NO_CACHE * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2 LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 12592) AND (b.`id_shop` = 1) LIMIT 1 |
0.228 ms | 0 | /src/Adapter/EntityMapper.php:71 | ||
| 40 | SELECT SQL_NO_CACHE * FROM `ps_manufacturer` a LEFT JOIN `ps_manufacturer_lang` `b` ON a.`id_manufacturer` = b.`id_manufacturer` AND b.`id_lang` = 2 LEFT JOIN `ps_manufacturer_shop` `c` ON a.`id_manufacturer` = c.`id_manufacturer` AND c.`id_shop` = 1 WHERE (a.`id_manufacturer` = 608) LIMIT 1 |
0.228 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 141 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `ps_product` p INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 12593) |
0.227 ms | 1 | /classes/Product.php:3860 | ||
| 194 | SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `ps_currency` c LEFT JOIN ps_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1) WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1 |
0.226 ms | 1 | /classes/Currency.php:1136 | ||
| 150 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `ps_product` p INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 12591) |
0.225 ms | 1 | /classes/Product.php:3860 | ||
| 72 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `ps_product` p INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 9664) |
0.223 ms | 1 | /classes/Product.php:3860 | ||
| 5 | SELECT SQL_NO_CACHE l.*, ls.`id_shop` FROM `ps_lang` l LEFT JOIN `ps_lang_shop` ls ON (l.id_lang = ls.id_lang) |
0.221 ms | 2 | /classes/Language.php:1080 | ||
| 173 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2) WHERE i.`id_product` = 0 ORDER BY `position` |
0.221 ms | 1 | Yes | /classes/Product.php:3545 | |
| 127 | SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute FROM ps_product_attribute pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE pa.id_product = 12592 LIMIT 1 |
0.218 ms | 1 | /classes/Product.php:1106 | ||
| 107 | SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute FROM ps_product_attribute pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE pa.id_product = 12589 LIMIT 1 |
0.217 ms | 1 | /classes/Product.php:1106 | ||
| 68 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 9664 AND image_shop.`cover` = 1 LIMIT 1 |
0.216 ms | 6 | /classes/Product.php:3570 | ||
| 56 | SELECT SQL_NO_CACHE * FROM `ps_manufacturer` a LEFT JOIN `ps_manufacturer_lang` `b` ON a.`id_manufacturer` = b.`id_manufacturer` AND b.`id_lang` = 1 LEFT JOIN `ps_manufacturer_shop` `c` ON a.`id_manufacturer` = c.`id_manufacturer` AND c.`id_shop` = 1 WHERE (a.`id_manufacturer` = 608) LIMIT 1 |
0.214 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 207 | SELECT SQL_NO_CACHE c.id_elementor FROM ps_iqit_elementor_content c LEFT JOIN ps_iqit_elementor_content_shop s ON c.id_elementor = s.id_elementor WHERE c.id_object = 608 AND c.hook = 929 AND s.id_shop = 1 LIMIT 1 |
0.214 ms | 5 | /modules/iqitelementor/src/IqitElementorContent.php:145 | ||
| 179 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2) WHERE i.`id_product` = 0 ORDER BY `position` |
0.212 ms | 1 | Yes | /classes/Product.php:3545 | |
| 121 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `ps_product` p INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 12590) |
0.210 ms | 1 | /classes/Product.php:3860 | ||
| 167 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2) WHERE i.`id_product` = 0 ORDER BY `position` |
0.210 ms | 1 | Yes | /classes/Product.php:3545 | |
| 52 | SELECT SQL_NO_CACHE cc.name FROM ps_cookiesplus_cookie cc LEFT JOIN ps_cookiesplus_cookie_lang ccl on cc.`id_cookiesplus_cookie` = ccl.`id_cookiesplus_cookie` WHERE `id_cookiesplus_finality` = 3 AND ccl.`id_lang` = 2 AND cc.`active` = 1 AND cc.`id_shop` = 1 ORDER BY cc.`name`; |
0.209 ms | 66 | Yes | /modules/cookiesplus/classes/CookiesPlusCookie.php:118 | |
| 147 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 12591 AND image_shop.`cover` = 1 LIMIT 1 |
0.209 ms | 6 | /classes/Product.php:3570 | ||
| 6 | SELECT SQL_NO_CACHE * FROM `ps_country` a LEFT JOIN `ps_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1 LEFT JOIN `ps_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1 WHERE (a.`id_country` = 6) LIMIT 1 |
0.208 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 42 | SELECT SQL_NO_CACHE * FROM `ps_currency` c ORDER BY `iso_code` ASC |
0.208 ms | 1 | Yes | /classes/Currency.php:709 | |
| 85 | SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute FROM ps_product_attribute pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE pa.id_product = 10353 LIMIT 1 |
0.205 ms | 1 | /classes/Product.php:1106 | ||
| 67 | SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute FROM ps_product_attribute pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE pa.id_product = 9664 LIMIT 1 |
0.204 ms | 1 | /classes/Product.php:1106 | ||
| 81 | SELECT SQL_NO_CACHE tr.*
FROM `ps_tax_rule` tr
JOIN `ps_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.201 ms | 0 | /classes/tax/TaxRulesTaxManager.php:109 | ||
| 202 | SELECT SQL_NO_CACHE SUM(`quantity`) FROM `ps_cart_product` WHERE `id_cart` = 0 LIMIT 1 |
0.201 ms | 1 | /classes/Cart.php:1303 | ||
| 176 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2) WHERE i.`id_product` = 0 ORDER BY `position` |
0.200 ms | 1 | Yes | /classes/Product.php:3545 | |
| 195 | SELECT SQL_NO_CACHE c.id_elementor FROM ps_iqit_elementor_content c WHERE c.active = 1 AND c.hook = 24 |
0.199 ms | 5 | /modules/iqitelementor/src/IqitElementorContent.php:127 | ||
| 170 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `ps_image` i INNER JOIN ps_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2) WHERE i.`id_product` = 0 ORDER BY `position` |
0.195 ms | 1 | Yes | /classes/Product.php:3545 | |
| 132 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `ps_product_shop` WHERE `id_product` = 12592 AND id_shop=1 LIMIT 1 |
0.195 ms | 1 | /classes/Product.php:6876 | ||
| 228 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitcontactpage" LIMIT 1 |
0.193 ms | 1 | /classes/module/Module.php:2664 | ||
| 96 | SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute FROM ps_product_attribute pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE pa.id_product = 10354 LIMIT 1 |
0.191 ms | 1 | /classes/Product.php:1106 | ||
| 218 | SELECT SQL_NO_CACHE * FROM ps_revi_products WHERE id_product = '12589' |
0.191 ms | 0 | /modules/revi/models/reviProductsModel.php:44 | ||
| 117 | SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute FROM ps_product_attribute pa INNER JOIN ps_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE pa.id_product = 12590 LIMIT 1 |
0.190 ms | 1 | /classes/Product.php:1106 | ||
| 45 | SELECT SQL_NO_CACHE * FROM `ps_currency` a LEFT JOIN `ps_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2 LEFT JOIN `ps_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1 WHERE (a.`id_currency` = 1) LIMIT 1 |
0.188 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 49 | SELECT SQL_NO_CACHE id_shop FROM `ps_currency_shop` WHERE `id_currency` = 1 AND id_shop = 1 LIMIT 1 |
0.187 ms | 1 | /classes/ObjectModel.php:1729 | ||
| 57 | SELECT SQL_NO_CACHE * FROM `ps_image_type` WHERE 1 AND `products` = 1 ORDER BY `width` DESC, `height` DESC, `name`ASC |
0.187 ms | 8 | Yes | /classes/ImageType.php:109 | |
| 193 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 76 AND `id_shop` = 1 LIMIT 1 |
0.185 ms | 1 | /classes/module/Module.php:2137 | ||
| 10 | SELECT SQL_NO_CACHE domain, domain_ssl FROM ps_shop_url WHERE main = 1 AND id_shop = 1 LIMIT 1 |
0.184 ms | 1 | /classes/shop/ShopUrl.php:182 | ||
| 196 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitlinksmanager" LIMIT 1 |
0.184 ms | 1 | /classes/module/Module.php:2664 | ||
| 208 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitwishlist" LIMIT 1 |
0.184 ms | 1 | /classes/module/Module.php:2664 | ||
| 4 | SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl FROM ps_shop s LEFT JOIN ps_shop_url su ON (s.id_shop = su.id_shop) WHERE s.id_shop = 1 AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1 |
0.179 ms | 1 | /classes/shop/Shop.php:218 | ||
| 61 | SELECT SQL_NO_CACHE * FROM `ps_country_lang` WHERE `id_country` = 6 |
0.178 ms | 2 | /src/Adapter/EntityMapper.php:79 | ||
| 161 | SELECT SQL_NO_CACHE state FROM ps_feature_flag WHERE name = 'multiple_image_format' LIMIT 1 |
0.178 ms | 1 | /classes/FeatureFlag.php:105 | ||
| 214 | SELECT SQL_NO_CACHE * FROM ps_revi_products WHERE id_product = '10353' |
0.178 ms | 0 | /modules/revi/models/reviProductsModel.php:44 | ||
| 134 | SELECT SQL_NO_CACHE SUM(quantity) FROM `ps_stock_available` WHERE (id_product = 12592) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.176 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 212 | SELECT SQL_NO_CACHE * FROM ps_revi_products WHERE id_product = '9664' |
0.176 ms | 0 | /modules/revi/models/reviProductsModel.php:44 | ||
| 19 | SELECT SQL_NO_CACHE name, alias FROM `ps_hook_alias` |
0.175 ms | 88 | /classes/Hook.php:342 | ||
| 30 | SELECT SQL_NO_CACHE * FROM `ps_group` a LEFT JOIN `ps_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1 WHERE (a.`id_group` = 1) LIMIT 1 |
0.175 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 98 | SELECT SQL_NO_CACHE cl.`link_rewrite` FROM `ps_category_lang` cl WHERE `id_lang` = 2 AND cl.id_shop = 1 AND cl.`id_category` = 418 LIMIT 1 |
0.175 ms | 1 | /classes/Category.php:1378 | ||
| 124 | SELECT SQL_NO_CACHE SUM(quantity) FROM `ps_stock_available` WHERE (id_product = 12590) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.174 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 231 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 94 AND `id_shop` = 1 LIMIT 1 |
0.174 ms | 1 | /classes/module/Module.php:2137 | ||
| 36 | SELECT SQL_NO_CACHE m.`id_module` as `active`, ms.`id_module` as `shop_active` FROM `ps_module` m LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module` WHERE `name` = "ps_mbo" LIMIT 1 |
0.173 ms | 1 | /modules/ps_mbo/ps_mbo.php:335 | ||
| 205 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitproductsnav" LIMIT 1 |
0.173 ms | 1 | /classes/module/Module.php:2664 | ||
| 211 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1 |
0.173 ms | 1 | /classes/module/Module.php:2137 | ||
| 8 | SELECT SQL_NO_CACHE * FROM `ps_lang` a LEFT JOIN `ps_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1 WHERE (a.`id_lang` = 2) LIMIT 1 |
0.172 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 93 | SELECT SQL_NO_CACHE SUM(quantity) FROM `ps_stock_available` WHERE (id_product = 10353) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.170 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 77 | SELECT SQL_NO_CACHE * FROM `ps_tax` a WHERE (a.`id_tax` = 1) LIMIT 1 |
0.169 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 144 | SELECT SQL_NO_CACHE SUM(quantity) FROM `ps_stock_available` WHERE (id_product = 12593) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.169 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 38 | SELECT SQL_NO_CACHE m.`id_module` as `active`, ms.`id_module` as `shop_active` FROM `ps_module` m LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module` WHERE `name` = "ps_mbo" LIMIT 1 |
0.168 ms | 1 | /modules/ps_mbo/ps_mbo.php:335 | ||
| 54 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_legalcompliance" LIMIT 1 |
0.168 ms | 0 | /classes/module/Module.php:2664 | ||
| 82 | SELECT SQL_NO_CACHE SUM(quantity) FROM `ps_stock_available` WHERE (id_product = 9664) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.167 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 198 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqithtmlandbanners" LIMIT 1 |
0.166 ms | 1 | /classes/module/Module.php:2664 | ||
| 216 | SELECT SQL_NO_CACHE * FROM ps_revi_products WHERE id_product = '10354' |
0.166 ms | 0 | /modules/revi/models/reviProductsModel.php:44 | ||
| 224 | SELECT SQL_NO_CACHE * FROM ps_revi_products WHERE id_product = '12593' |
0.166 ms | 0 | /modules/revi/models/reviProductsModel.php:44 | ||
| 226 | SELECT SQL_NO_CACHE * FROM ps_revi_products WHERE id_product = '12591' |
0.166 ms | 0 | /modules/revi/models/reviProductsModel.php:44 | ||
| 151 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `ps_product_shop` WHERE `id_product` = 12591 AND id_shop=1 LIMIT 1 |
0.165 ms | 1 | /classes/Product.php:6876 | ||
| 197 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1 |
0.165 ms | 1 | /classes/module/Module.php:2137 | ||
| 91 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `ps_product_shop` WHERE `id_product` = 10353 AND id_shop=1 LIMIT 1 |
0.164 ms | 1 | /classes/Product.php:6876 | ||
| 99 | SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 418 LIMIT 1 |
0.164 ms | 1 | /classes/Product.php:5659 | ||
| 222 | SELECT SQL_NO_CACHE * FROM ps_revi_products WHERE id_product = '12592' |
0.164 ms | 0 | /modules/revi/models/reviProductsModel.php:44 | ||
| 206 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 82 AND `id_shop` = 1 LIMIT 1 |
0.163 ms | 1 | /classes/module/Module.php:2137 | ||
| 60 | SELECT SQL_NO_CACHE * FROM `ps_country` a LEFT JOIN `ps_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1 WHERE (a.`id_country` = 6) LIMIT 1 |
0.162 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 210 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "productcomments" LIMIT 1 |
0.162 ms | 1 | /classes/module/Module.php:2664 | ||
| 162 | SELECT SQL_NO_CACHE * FROM `ps_image_type` |
0.161 ms | 8 | /classes/ImageType.php:161 | ||
| 220 | SELECT SQL_NO_CACHE * FROM ps_revi_products WHERE id_product = '12590' |
0.161 ms | 0 | /modules/revi/models/reviProductsModel.php:44 | ||
| 129 | SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1 |
0.160 ms | 1 | /classes/Product.php:5659 | ||
| 15 | SELECT SQL_NO_CACHE `name`, `alias` FROM `ps_hook_alias` |
0.160 ms | 88 | /classes/Hook.php:290 | ||
| 200 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitsearch" LIMIT 1 |
0.160 ms | 1 | /classes/module/Module.php:2664 | ||
| 203 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitmegamenu" LIMIT 1 |
0.160 ms | 1 | /classes/module/Module.php:2664 | ||
| 47 | SELECT SQL_NO_CACHE * FROM `ps_currency` a LEFT JOIN `ps_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1 WHERE (a.`id_currency` = 1) LIMIT 1 |
0.159 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 48 | SELECT SQL_NO_CACHE * FROM `ps_currency_lang` WHERE `id_currency` = 1 |
0.159 ms | 2 | /src/Adapter/EntityMapper.php:79 | ||
| 41 | SELECT SQL_NO_CACHE id_shop FROM `ps_manufacturer_shop` WHERE `id_manufacturer` = 608 AND id_shop = 1 LIMIT 1 |
0.158 ms | 1 | /classes/ObjectModel.php:1729 | ||
| 123 | SELECT SQL_NO_CACHE `reduction` FROM `ps_product_group_reduction_cache` WHERE `id_product` = 12590 AND `id_group` = 1 LIMIT 1 |
0.156 ms | 0 | /classes/GroupReduction.php:156 | ||
| 232 | SELECT SQL_NO_CACHE data FROM `ps_ganalytics_data` WHERE id_cart = 0 AND id_shop = 1 LIMIT 1 |
0.156 ms | 0 | /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43 | ||
| 148 | SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1 |
0.156 ms | 1 | /classes/Product.php:5659 | ||
| 69 | SELECT SQL_NO_CACHE cl.`link_rewrite` FROM `ps_category_lang` cl WHERE `id_lang` = 2 AND cl.id_shop = 1 AND cl.`id_category` = 374 LIMIT 1 |
0.155 ms | 1 | /classes/Category.php:1378 | ||
| 78 | SELECT SQL_NO_CACHE * FROM `ps_tax_lang` WHERE `id_tax` = 1 |
0.155 ms | 2 | /src/Adapter/EntityMapper.php:79 | ||
| 209 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 88 AND `id_shop` = 1 LIMIT 1 |
0.155 ms | 1 | /classes/module/Module.php:2137 | ||
| 31 | SELECT SQL_NO_CACHE * FROM `ps_group_lang` WHERE `id_group` = 1 |
0.153 ms | 2 | /src/Adapter/EntityMapper.php:79 | ||
| 3 | SELECT SQL_NO_CACHE * FROM `ps_shop` a WHERE (a.`id_shop` = 1) LIMIT 1 |
0.153 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 23 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ets_superspeed" LIMIT 1 |
0.152 ms | 1 | /classes/module/Module.php:2664 | ||
| 43 | SELECT SQL_NO_CACHE `id_lang` FROM `ps_lang` WHERE `locale` = 'pt-pt' OR `language_code` = 'pt-pt' LIMIT 1 |
0.151 ms | 2 | /classes/Language.php:883 | ||
| 199 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1 |
0.151 ms | 1 | /classes/module/Module.php:2137 | ||
| 201 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 85 AND `id_shop` = 1 LIMIT 1 |
0.150 ms | 1 | /classes/module/Module.php:2137 | ||
| 182 | SELECT SQL_NO_CACHE `id_product_attribute` FROM `ps_product_attribute` WHERE `id_product` = 12591 |
0.149 ms | 1 | /classes/Product.php:2902 | ||
| 204 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 80 AND `id_shop` = 1 LIMIT 1 |
0.149 ms | 1 | /classes/module/Module.php:2137 | ||
| 88 | SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1 |
0.148 ms | 1 | /classes/Product.php:5659 | ||
| 63 | SELECT SQL_NO_CACHE * FROM ps_revslider_sliders |
0.147 ms | 1 | /modules/revsliderprestashop/includes/revslider_db.class.php:214 | ||
| 87 | SELECT SQL_NO_CACHE cl.`link_rewrite` FROM `ps_category_lang` cl WHERE `id_lang` = 2 AND cl.id_shop = 1 AND cl.`id_category` = 18 LIMIT 1 |
0.146 ms | 1 | /classes/Category.php:1378 | ||
| 37 | SELECT SQL_NO_CACHE `active` FROM `ps_module` WHERE `name` = "ps_mbo" LIMIT 1 |
0.146 ms | 1 | /modules/ps_mbo/ps_mbo.php:325 | ||
| 104 | SELECT SQL_NO_CACHE SUM(quantity) FROM `ps_stock_available` WHERE (id_product = 10354) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.143 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 35 | SELECT SQL_NO_CACHE `active` FROM `ps_module` WHERE `name` = "ps_mbo" LIMIT 1 |
0.142 ms | 1 | /modules/ps_mbo/ps_mbo.php:325 | ||
| 79 | SELECT SQL_NO_CACHE `reduction` FROM `ps_product_group_reduction_cache` WHERE `id_product` = 9664 AND `id_group` = 1 LIMIT 1 |
0.141 ms | 0 | /classes/GroupReduction.php:156 | ||
| 153 | SELECT SQL_NO_CACHE SUM(quantity) FROM `ps_stock_available` WHERE (id_product = 12591) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.141 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 114 | SELECT SQL_NO_CACHE SUM(quantity) FROM `ps_stock_available` WHERE (id_product = 12589) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.140 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 44 | SELECT SQL_NO_CACHE c.id_currency FROM `ps_currency` c WHERE (iso_code = 'EUR') LIMIT 1 |
0.140 ms | 1 | /classes/Currency.php:893 | ||
| 80 | SELECT SQL_NO_CACHE `reduction` FROM `ps_group` WHERE `id_group` = 1 LIMIT 1 |
0.140 ms | 1 | /classes/Group.php:154 | ||
| 112 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `ps_product_shop` WHERE `id_product` = 12589 AND id_shop=1 LIMIT 1 |
0.140 ms | 1 | /classes/Product.php:6876 | ||
| 55 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1 |
0.138 ms | 0 | /classes/module/Module.php:2137 | ||
| 58 | SELECT SQL_NO_CACHE format FROM `ps_address_format` WHERE `id_country` = 6 LIMIT 1 |
0.138 ms | 1 | /classes/AddressFormat.php:656 | ||
| 139 | SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1 |
0.138 ms | 1 | /classes/Product.php:5659 | ||
| 133 | SELECT SQL_NO_CACHE `reduction` FROM `ps_product_group_reduction_cache` WHERE `id_product` = 12592 AND `id_group` = 1 LIMIT 1 |
0.137 ms | 0 | /classes/GroupReduction.php:156 | ||
| 12 | SELECT SQL_NO_CACHE `id_lang` FROM `ps_lang` WHERE `iso_code` = 'pt' LIMIT 1 |
0.137 ms | 2 | /classes/Language.php:854 | ||
| 109 | SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1 |
0.135 ms | 1 | /classes/Product.php:5659 | ||
| 142 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `ps_product_shop` WHERE `id_product` = 12593 AND id_shop=1 LIMIT 1 |
0.135 ms | 1 | /classes/Product.php:6876 | ||
| 46 | SELECT SQL_NO_CACHE `id_lang` FROM `ps_lang` WHERE `locale` = 'pt-pt' OR `language_code` = 'pt-pt' LIMIT 1 |
0.134 ms | 2 | /classes/Language.php:883 | ||
| 122 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `ps_product_shop` WHERE `id_product` = 12590 AND id_shop=1 LIMIT 1 |
0.133 ms | 1 | /classes/Product.php:6876 | ||
| 33 | SELECT SQL_NO_CACHE * FROM `ps_hook_module_exceptions` WHERE `id_shop` IN (1) |
0.132 ms | 1 | /classes/module/Module.php:2046 | ||
| 92 | SELECT SQL_NO_CACHE `reduction` FROM `ps_product_group_reduction_cache` WHERE `id_product` = 10353 AND `id_group` = 1 LIMIT 1 |
0.131 ms | 0 | /classes/GroupReduction.php:156 | ||
| 24 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 108 AND `id_shop` = 1 LIMIT 1 |
0.130 ms | 1 | /classes/module/Module.php:2137 | ||
| 119 | SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1 |
0.130 ms | 1 | /classes/Product.php:5659 | ||
| 62 | SELECT SQL_NO_CACHE id_required_field, object_name, field_name FROM ps_required_field |
0.128 ms | 1 | /classes/ObjectModel.php:1592 | ||
| 9 | SELECT SQL_NO_CACHE id_shop FROM `ps_lang_shop` WHERE `id_lang` = 2 AND id_shop = 1 LIMIT 1 |
0.127 ms | 1 | /classes/ObjectModel.php:1729 | ||
| 25 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ybc_blog" LIMIT 1 |
0.127 ms | 0 | /modules/ets_superspeed/classes/ets_superspeed_defines.php:2381 | ||
| 102 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `ps_product_shop` WHERE `id_product` = 10354 AND id_shop=1 LIMIT 1 |
0.126 ms | 1 | /classes/Product.php:6876 | ||
| 7 | SELECT SQL_NO_CACHE * FROM `ps_shop_group` a WHERE (a.`id_shop_group` = 1) LIMIT 1 |
0.125 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 70 | SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 374 LIMIT 1 |
0.125 ms | 1 | /classes/Product.php:5659 | ||
| 73 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `ps_product_shop` WHERE `id_product` = 9664 AND id_shop=1 LIMIT 1 |
0.125 ms | 1 | /classes/Product.php:6876 | ||
| 32 | SELECT SQL_NO_CACHE id_shop FROM `ps_group_shop` WHERE `id_group` = 1 AND id_shop = 1 LIMIT 1 |
0.122 ms | 1 | /classes/ObjectModel.php:1729 | ||
| 152 | SELECT SQL_NO_CACHE `reduction` FROM `ps_product_group_reduction_cache` WHERE `id_product` = 12591 AND `id_group` = 1 LIMIT 1 |
0.117 ms | 0 | /classes/GroupReduction.php:156 | ||
| 26 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_imageslider" LIMIT 1 |
0.116 ms | 1 | /modules/ets_superspeed/classes/ets_superspeed_defines.php:2381 | ||
| 59 | SELECT SQL_NO_CACHE `need_identification_number` FROM `ps_country` WHERE `id_country` = 6 LIMIT 1 |
0.116 ms | 1 | /classes/Country.php:405 | ||
| 28 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_banner" LIMIT 1 |
0.112 ms | 1 | /modules/ets_superspeed/classes/ets_superspeed_defines.php:2381 | ||
| 27 | SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "blockbanner" LIMIT 1 |
0.110 ms | 0 | /modules/ets_superspeed/classes/ets_superspeed_defines.php:2381 | ||
| 143 | SELECT SQL_NO_CACHE `reduction` FROM `ps_product_group_reduction_cache` WHERE `id_product` = 12593 AND `id_group` = 1 LIMIT 1 |
0.108 ms | 0 | /classes/GroupReduction.php:156 | ||
| 103 | SELECT SQL_NO_CACHE `reduction` FROM `ps_product_group_reduction_cache` WHERE `id_product` = 10354 AND `id_group` = 1 LIMIT 1 |
0.107 ms | 0 | /classes/GroupReduction.php:156 | ||
| 113 | SELECT SQL_NO_CACHE `reduction` FROM `ps_product_group_reduction_cache` WHERE `id_product` = 12589 AND `id_group` = 1 LIMIT 1 |
0.107 ms | 0 | /classes/GroupReduction.php:156 |
| 29 queries |
SELECT * FROM `ps_product` a LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX |
| 12 queries |
SELECT `id_module` FROM `ps_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX |
| 8 queries |
SELECT image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
WHERE i.`id_product` = XX
AND image_shop.`cover` = XX LIMIT XX
|
| 8 queries |
SELECT name FROM ps_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX |
| 8 queries |
SELECT product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `ps_product` p INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX) LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX) WHERE (p.`id_product` = XX) |
| 8 queries |
SELECT `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = XX AND id_shop=XX LIMIT XX
|
| 8 queries |
SELECT `reduction` FROM `ps_product_group_reduction_cache` WHERE `id_product` = XX AND `id_group` = XX LIMIT XX |
| 8 queries |
SELECT SUM(quantity) FROM `ps_stock_available` WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX |
| 8 queries |
SELECT
COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
COALESCE(SUM(first_level_quantity), XX) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = XX
AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = XX
AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
pr.`pack_stock_type` = XX
AND XX = XX
))) as q LIMIT XX
|
| 8 queries |
SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
WHERE pf.id_product = XX
ORDER BY f.position ASC
|
| 8 queries |
SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
WHERE i.`id_product` = XX
ORDER BY `position`
|
| 8 queries |
SELECT * FROM ps_revi_products WHERE id_product = 'XX' |
| 8 queries |
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > XX, XX, XX)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) LEFT JOIN ps_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX AND stock.id_shop_group = XX )
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > XX
ORDER BY a.`position` ASC;
|
| 7 queries |
SELECT product_attribute_shop.id_product_attribute
FROM ps_product_attribute pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
WHERE pa.id_product = XX LIMIT XX
|
| 6 queries |
SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = XX
|
| 3 queries |
SELECT cc.name
FROM ps_cookiesplus_cookie cc LEFT JOIN ps_cookiesplus_cookie_lang ccl on cc.`id_cookiesplus_cookie` = ccl.`id_cookiesplus_cookie`
WHERE
`id_cookiesplus_finality` = XX
AND ccl.`id_lang` = XX AND cc.`active` = XX AND cc.`id_shop` = XX ORDER BY cc.`name`;
|
| 3 queries |
SELECT cl.`link_rewrite` FROM `ps_category_lang` cl WHERE `id_lang` = XX AND cl.id_shop = XX AND cl.`id_category` = XX LIMIT XX |
| 2 queries |
SELECT `active`
FROM `ps_module`
WHERE `name` = "ps_mbo" LIMIT XX
|
| 2 queries |
SELECT m.`id_module` as `active`, ms.`id_module` as `shop_active`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module`
WHERE `name` = "ps_mbo" LIMIT XX
|
| 2 queries |
SELECT * FROM `ps_manufacturer` a LEFT JOIN `ps_manufacturer_lang` `b` ON a.`id_manufacturer` = b.`id_manufacturer` AND b.`id_lang` = XX LEFT JOIN `ps_manufacturer_shop` `c` ON a.`id_manufacturer` = c.`id_manufacturer` AND c.`id_shop` = XX WHERE (a.`id_manufacturer` = XX) LIMIT XX |
| 2 queries |
SELECT `id_lang` FROM `ps_lang`
WHERE `locale` = 'pt-pt'
OR `language_code` = 'pt-pt' LIMIT XX
|
| 2 queries |
SELECT t.id_template, t.template_filters AS filters, t.additional_settings, tl.data AS lang
FROM ps_af_templates t
LEFT JOIN ps_af_templates_lang tl
ON tl.id_template = t.id_template AND tl.id_shop = t.id_shop AND tl.id_lang = XX
INNER JOIN `ps_af_manufacturer_templates` ct
ON ct.id_template = t.id_template AND ct.id_shop = t.id_shop
AND ct.`id_manufacturer` IN (XX, XX)
WHERE t.active = XX AND t.template_controller = 'manufacturer'
AND t.id_shop = XX
ORDER BY ct.`id_manufacturer` DESC, t.id_template DESC LIMIT XX
|
| 2 queries |
SELECT tr.*
FROM `ps_tax_rule` tr
JOIN `ps_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = XX
AND tr.`id_country` = XX
AND tr.`id_tax_rules_group` = XX
AND tr.`id_state` IN (XX, XX)
AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
|
| 2 queries |
SELECT XX FROM `ps_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX |
| 48 product |
| 48 product_shop |
| 31 product_lang |
| 28 module |
| 24 product_attribute_shop |
| 21 module_shop |
| 18 stock_available |
| 17 image_shop |
| 17 cart_product |
| 16 product_attribute |
| 16 image |
| 12 category_lang |
| 9 image_lang |
| 8 product_group_reduction_cache |
| 8 pack |
| 8 feature_product |
| 8 feature_lang |
| 8 feature_value_lang |
| 8 feature |
| 8 feature_shop |
| 8 revi_products |
| 8 product_attribute_combination |
| 8 attribute |
| 8 attribute_lang |
| 8 attribute_group |
| 6 lang |
| 6 hook |
| 5 currency |
| 4 shop_url |
| 4 shop |
| 4 lang_shop |
| 4 currency_shop |
| 3 country |
| 3 hook_alias |
| 3 manufacturer |
| 3 manufacturer_shop |
| 3 cookiesplus_cookie |
| 3 cookiesplus_cookie_lang |
| 3 category_product |
| 3 category |
| 2 shop_group |
| 2 configuration |
| 2 country_lang |
| 2 country_shop |
| 2 hook_module |
| 2 group |
| 2 group_shop |
| 2 manufacturer_lang |
| 2 currency_lang |
| 2 image_type |
| 2 af_templates |
| 2 af_templates_lang |
| 2 af_manufacturer_templates |
| 2 category_group |
| 2 tax_rule |
| 2 tax_rules_group |
| 2 cart_rule |
| 2 iqit_elementor_content |
| 1 configuration_lang |
| 1 module_group |
| 1 meta |
| 1 meta_lang |
| 1 group_lang |
| 1 hook_module_exceptions |
| 1 cookiesplus_finality |
| 1 cookiesplus_finality_lang |
| 1 address_format |
| 1 required_field |
| 1 revslider_sliders |
| 1 tax |
| 1 tax_lang |
| 1 feature_flag |
| 1 iqit_elementor_content_shop |
| 1 ganalytics_data |
| 1 category_shop |
| 1 connections |
| 1 ets_superspeed_cache_page |
| Name | Instances | Source |
|---|---|---|
| Product | 31 |
/classes/Link.php:113 (__construct) [id: 9664]
/classes/Link.php:113 (__construct) [id: 10353] /classes/Link.php:113 (__construct) [id: 10354] /classes/Link.php:113 (__construct) [id: 12589] /classes/Link.php:113 (__construct) [id: 12590] /classes/Link.php:113 (__construct) [id: 12592] /classes/Link.php:113 (__construct) [id: 12593] /classes/Link.php:113 (__construct) [id: 12591] /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9664] /src/Adapter/Presenter/Product/ProductLazyArray.php:714 (__construct) [id: 9664] /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10353] /src/Adapter/Presenter/Product/ProductLazyArray.php:714 (__construct) [id: 10353] /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10354] /src/Adapter/Presenter/Product/ProductLazyArray.php:714 (__construct) [id: 10354] /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12589] /src/Adapter/Presenter/Product/ProductLazyArray.php:714 (__construct) [id: 12589] /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12590] /src/Adapter/Presenter/Product/ProductLazyArray.php:714 (__construct) [id: 12590] /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12592] /src/Adapter/Presenter/Product/ProductLazyArray.php:714 (__construct) [id: 12592] /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12593] /src/Adapter/Presenter/Product/ProductLazyArray.php:714 (__construct) [id: 12593] /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12591] /classes/Link.php:113 (__construct) [id: 9664] /classes/Link.php:113 (__construct) [id: 10353] /classes/Link.php:113 (__construct) [id: 10354] /classes/Link.php:113 (__construct) [id: 12589] /classes/Link.php:113 (__construct) [id: 12590] /classes/Link.php:113 (__construct) [id: 12592] /classes/Link.php:113 (__construct) [id: 12593] /classes/Link.php:113 (__construct) [id: 12591] |
| Address | 4 |
/classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ] /classes/Product.php:3804 (__construct) [id: ] /classes/Product.php:5964 (__construct) [id: ] |
| Language | 4 |
/config/config.inc.php:211 (__construct) [id: 2]
/classes/Tools.php:641 (__construct) [id: 2] /classes/Tools.php:560 (__construct) [id: 2] /modules/revi/revi.php:83 (__construct) [id: 2] |
| Manufacturer | 4 |
/controllers/front/listing/ManufacturerController.php:65 (__construct) [id: 608]
/classes/Meta.php:421 (__construct) [id: 608] /classes/Link.php:657 (__construct) [id: 608] /classes/Link.php:657 (__construct) [id: 608] |
| Country | 3 |
/config/config.inc.php:146 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6] /classes/controller/FrontController.php:1779 (__construct) [id: 6] |
| Cart | 2 |
/classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ] |
| State | 2 |
/classes/AddressFormat.php:404 (__construct) [id: 0]
/classes/controller/FrontController.php:1778 (__construct) [id: 0] |
| Currency | 2 |
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1] |
| Tax | 1 |
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
|
| AddressFormat | 1 |
/classes/controller/FrontController.php:1773 (generateAddress) [id: ]
|
| Shop | 1 |
/config/config.inc.php:117 (initialize) [id: 1]
|
| Risk | 1 |
/classes/controller/FrontController.php:1705 (__construct) [id: ]
|
| Gender | 1 |
/classes/controller/FrontController.php:1702 (__construct) [id: 0]
|
| Group | 1 |
/modules/ets_superspeed/classes/cache.php:74 (getCurrent) [id: 1]
|
| Customer | 1 |
/config/config.inc.php:264 (__construct) [id: ]
|
| ShopGroup | 1 |
/classes/shop/Shop.php:561 (__construct) [id: 1]
|
| ConnectionsSource | 1 |
/modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]
|
| # | Filename |
|---|---|
| 0 | /index.php |
| 1 | /config/config.inc.php |
| 2 | /config/defines.inc.php |
| 3 | /config/autoload.php |
| 4 | /vendor/autoload.php |
| 5 | /vendor/composer/autoload_real.php |
| 6 | /vendor/composer/platform_check.php |
| 7 | /vendor/composer/ClassLoader.php |
| 8 | /vendor/composer/include_paths.php |
| 9 | /vendor/composer/autoload_static.php |
| 10 | /vendor/symfony/polyfill-php72/bootstrap.php |
| 11 | /vendor/symfony/polyfill-mbstring/bootstrap.php |
| 12 | /vendor/symfony/polyfill-mbstring/bootstrap80.php |
| 13 | /vendor/symfony/polyfill-intl-normalizer/bootstrap.php |
| 14 | /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php |
| 15 | /vendor/symfony/polyfill-intl-idn/bootstrap.php |
| 16 | /vendor/symfony/deprecation-contracts/function.php |
| 17 | /vendor/ralouphie/getallheaders/src/getallheaders.php |
| 18 | /vendor/symfony/polyfill-ctype/bootstrap.php |
| 19 | /vendor/symfony/polyfill-ctype/bootstrap80.php |
| 20 | /vendor/symfony/polyfill-php80/bootstrap.php |
| 21 | /vendor/guzzlehttp/promises/src/functions_include.php |
| 22 | /vendor/guzzlehttp/promises/src/functions.php |
| 23 | /vendor/guzzlehttp/guzzle/src/functions_include.php |
| 24 | /vendor/guzzlehttp/guzzle/src/functions.php |
| 25 | /vendor/symfony/polyfill-iconv/bootstrap.php |
| 26 | /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php |
| 27 | /vendor/jakeasmith/http_build_url/src/http_build_url.php |
| 28 | /vendor/lcobucci/jwt/compat/class-aliases.php |
| 29 | /vendor/lcobucci/jwt/src/Token.php |
| 30 | /vendor/lcobucci/jwt/src/Signature.php |
| 31 | /vendor/lcobucci/jwt/compat/json-exception-polyfill.php |
| 32 | /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php |
| 33 | /vendor/swiftmailer/swiftmailer/lib/swift_required.php |
| 34 | /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php |
| 35 | /vendor/symfony/polyfill-intl-icu/bootstrap.php |
| 36 | /vendor/symfony/polyfill-php73/bootstrap.php |
| 37 | /vendor/symfony/polyfill-php81/bootstrap.php |
| 38 | /vendor/api-platform/core/src/deprecation.php |
| 39 | /vendor/api-platform/core/src/Api/FilterInterface.php |
| 40 | /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php |
| 41 | /vendor/api-platform/core/src/deprecated_interfaces.php |
| 42 | /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php |
| 43 | /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php |
| 44 | /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php |
| 45 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php |
| 46 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php |
| 47 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php |
| 48 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php |
| 49 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php |
| 50 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php |
| 51 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php |
| 52 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php |
| 53 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php |
| 54 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php |
| 55 | /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php |
| 56 | /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php |
| 57 | /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php |
| 58 | /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php |
| 59 | /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php |
| 60 | /vendor/api-platform/core/src/Exception/ExceptionInterface.php |
| 61 | /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php |
| 62 | /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php |
| 63 | /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php |
| 64 | /vendor/api-platform/core/src/Documentation/DocumentationInterface.php |
| 65 | /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php |
| 66 | /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php |
| 67 | /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php |
| 68 | /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php |
| 69 | /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php |
| 70 | /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php |
| 71 | /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php |
| 72 | /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php |
| 73 | /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php |
| 74 | /vendor/api-platform/core/src/Validator/ValidatorInterface.php |
| 75 | /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php |
| 76 | /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php |
| 77 | /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php |
| 78 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php |
| 79 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php |
| 80 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php |
| 81 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php |
| 82 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php |
| 83 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php |
| 84 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php |
| 85 | /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php |
| 86 | /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php |
| 87 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php |
| 88 | /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php |
| 89 | /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php |
| 90 | /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php |
| 91 | /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php |
| 92 | /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php |
| 93 | /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php |
| 94 | /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php |
| 95 | /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php |
| 96 | /vendor/psr/container/src/ContainerInterface.php |
| 97 | /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php |
| 98 | /vendor/ircmaxell/password-compat/lib/password.php |
| 99 | /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php |
| 100 | /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php |
| 101 | /src/Core/Version.php |
| 102 | /config/alias.php |
| 103 | /vendor/prestashop/autoload/src/PrestashopAutoload.php |
| 104 | /vendor/prestashop/autoload/src/LegacyClassLoader.php |
| 105 | /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php |
| 106 | /vendor/prestashop/autoload/src/Autoloader.php |
| 107 | /config/bootstrap.php |
| 108 | /src/Core/ContainerBuilder.php |
| 109 | /src/Core/Foundation/IoC/Container.php |
| 110 | /src/Adapter/ServiceLocator.php |
| 111 | /var/cache/dev/appParameters.php |
| 114 | /var/cache/dev/class_index.php |
| 115 | /classes/controller/Controller.php |
| 117 | /classes/ObjectModel.php |
| 118 | /src/Core/Foundation/Database/EntityInterface.php |
| 120 | /classes/db/Db.php |
| 122 | /classes/Hook.php |
| 124 | /classes/module/Module.php |
| 125 | /src/Core/Module/Legacy/ModuleInterface.php |
| 127 | /classes/Tools.php |
| 128 | /classes/Context.php |
| 129 | /classes/shop/Shop.php |
| 130 | /src/Core/Security/PasswordGenerator.php |
| 131 | /classes/db/DbPDO.php |
| 132 | /classes/AddressFormat.php |
| 133 | /classes/cache/Cache.php |
| 134 | /classes/cache/CacheRedis.php |
| 135 | /modules/rediscache/classes/RCRedisCache.php |
| 136 | /modules/rediscache/vendor/autoload.php |
| 137 | /modules/rediscache/vendor/composer/autoload_real.php |
| 138 | /modules/rediscache/vendor/composer/platform_check.php |
| 139 | /modules/rediscache/vendor/composer/autoload_static.php |
| 140 | /modules/rediscache/vendor/predis/predis/src/Client.php |
| 141 | /modules/rediscache/vendor/predis/predis/src/ClientInterface.php |
| 142 | /app/config/parameters.php |
| 143 | /modules/rediscache/vendor/predis/predis/src/Configuration/Options.php |
| 144 | /modules/rediscache/vendor/predis/predis/src/Configuration/OptionsInterface.php |
| 145 | /modules/rediscache/vendor/predis/predis/src/Configuration/Option/Connections.php |
| 146 | /modules/rediscache/vendor/predis/predis/src/Configuration/OptionInterface.php |
| 147 | /modules/rediscache/vendor/predis/predis/src/Connection/Factory.php |
| 148 | /modules/rediscache/vendor/predis/predis/src/Connection/FactoryInterface.php |
| 149 | /modules/rediscache/vendor/predis/predis/src/Connection/Parameters.php |
| 150 | /modules/rediscache/vendor/predis/predis/src/Connection/ParametersInterface.php |
| 151 | /modules/rediscache/vendor/predis/predis/src/Connection/StreamConnection.php |
| 152 | /modules/rediscache/vendor/predis/predis/src/Connection/AbstractConnection.php |
| 153 | /modules/rediscache/vendor/predis/predis/src/Connection/NodeConnectionInterface.php |
| 154 | /modules/rediscache/vendor/predis/predis/src/Connection/ConnectionInterface.php |
| 155 | /modules/rediscache/vendor/predis/predis/src/Command/RawCommand.php |
| 156 | /modules/rediscache/vendor/predis/predis/src/Command/CommandInterface.php |
| 157 | /modules/rediscache/vendor/predis/predis/src/Configuration/Option/Commands.php |
| 158 | /modules/rediscache/vendor/predis/predis/src/Command/RedisFactory.php |
| 159 | /modules/rediscache/vendor/predis/predis/src/Command/Factory.php |
| 160 | /modules/rediscache/vendor/predis/predis/src/Command/FactoryInterface.php |
| 161 | /modules/rediscache/vendor/predis/predis/src/Command/Redis/KEYS.php |
| 162 | /modules/rediscache/vendor/predis/predis/src/Command/Command.php |
| 163 | /modules/rediscache/vendor/predis/predis/src/Response/Error.php |
| 164 | /modules/rediscache/vendor/predis/predis/src/Response/ErrorInterface.php |
| 165 | /modules/rediscache/vendor/predis/predis/src/Response/ResponseInterface.php |
| 166 | /modules/rediscache/vendor/predis/predis/src/CommunicationException.php |
| 167 | /modules/rediscache/vendor/predis/predis/src/PredisException.php |
| 168 | /modules/rediscache/vendor/predis/predis/src/Connection/ConnectionException.php |
| 169 | /src/Core/Security/Hashing.php |
| 170 | /classes/Configuration.php |
| 171 | /classes/Validate.php |
| 172 | /src/Adapter/EntityMapper.php |
| 173 | /classes/db/DbQuery.php |
| 174 | /src/Core/Addon/Theme/ThemeManagerBuilder.php |
| 175 | /vendor/psr/log/Psr/Log/NullLogger.php |
| 176 | /vendor/psr/log/Psr/Log/AbstractLogger.php |
| 177 | /vendor/psr/log/Psr/Log/LoggerInterface.php |
| 178 | /src/Adapter/Configuration.php |
| 179 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php |
| 180 | /src/Core/Domain/Configuration/ShopConfigurationInterface.php |
| 181 | /src/Core/ConfigurationInterface.php |
| 182 | /src/Core/Addon/Theme/ThemeRepository.php |
| 183 | /src/Core/Addon/AddonRepositoryInterface.php |
| 184 | /src/Core/Domain/Shop/ValueObject/ShopConstraint.php |
| 185 | /src/Core/Addon/Theme/Theme.php |
| 186 | /src/Core/Addon/AddonInterface.php |
| 187 | /src/Core/Util/File/YamlParser.php |
| 188 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php |
| 189 | /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php |
| 190 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php |
| 191 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php |
| 192 | /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php |
| 193 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php |
| 194 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php |
| 195 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php |
| 196 | /var/cache/dev/yaml/bd2141a4d1fe944cdd5dd4018a251cd9.php |
| 197 | /src/Core/Util/ArrayFinder.php |
| 198 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php |
| 199 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php |
| 200 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php |
| 201 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php |
| 202 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php |
| 203 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php |
| 204 | /config/defines_uri.inc.php |
| 205 | /classes/Language.php |
| 206 | /src/Core/Language/LanguageInterface.php |
| 207 | /classes/Country.php |
| 208 | /classes/PrestaShopCollection.php |
| 209 | /classes/shop/ShopGroup.php |
| 210 | /classes/Cookie.php |
| 211 | /classes/PhpEncryption.php |
| 212 | /classes/PhpEncryptionEngine.php |
| 213 | /vendor/defuse/php-encryption/src/Key.php |
| 214 | /vendor/defuse/php-encryption/src/Encoding.php |
| 215 | /vendor/defuse/php-encryption/src/Core.php |
| 216 | /vendor/defuse/php-encryption/src/Crypto.php |
| 217 | /vendor/defuse/php-encryption/src/KeyOrPassword.php |
| 218 | /vendor/defuse/php-encryption/src/RuntimeTests.php |
| 219 | /vendor/defuse/php-encryption/src/DerivedKeys.php |
| 220 | /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php |
| 221 | /vendor/defuse/php-encryption/src/Exception/CryptoException.php |
| 222 | /src/Core/Session/SessionHandler.php |
| 223 | /src/Core/Session/SessionHandlerInterface.php |
| 224 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php |
| 225 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php |
| 226 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php |
| 227 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php |
| 228 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php |
| 229 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php |
| 230 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php |
| 231 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php |
| 232 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php |
| 233 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php |
| 234 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php |
| 235 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php |
| 236 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php |
| 237 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php |
| 238 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php |
| 239 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php |
| 240 | /config/smarty.config.inc.php |
| 241 | /classes/Smarty/SmartyDev.php |
| 242 | /vendor/smarty/smarty/libs/Smarty.class.php |
| 243 | /vendor/smarty/smarty/libs/functions.php |
| 244 | /vendor/smarty/smarty/libs/Autoloader.php |
| 245 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php |
| 246 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php |
| 247 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php |
| 248 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php |
| 249 | /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php |
| 250 | /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php |
| 251 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php |
| 252 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php |
| 253 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php |
| 254 | /config/smartyfront.config.inc.php |
| 255 | /classes/Smarty/SmartyResourceModule.php |
| 256 | /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php |
| 257 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php |
| 258 | /classes/Smarty/SmartyResourceParent.php |
| 259 | /classes/Smarty/SmartyLazyRegister.php |
| 260 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php |
| 261 | /vendor/smarty/smarty/libs/plugins/modifier.truncate.php |
| 262 | /classes/Customer.php |
| 263 | /classes/Group.php |
| 264 | /override/classes/Link.php |
| 265 | /classes/Link.php |
| 266 | /classes/shop/ShopUrl.php |
| 267 | /override/classes/Dispatcher.php |
| 268 | /classes/Dispatcher.php |
| 269 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php |
| 270 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php |
| 271 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php |
| 272 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php |
| 273 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php |
| 274 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php |
| 275 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php |
| 276 | /src/Adapter/SymfonyContainer.php |
| 277 | /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php |
| 278 | /config/db_slave_server.inc.php |
| 279 | /src/Adapter/ContainerBuilder.php |
| 280 | /src/Adapter/Environment.php |
| 281 | /src/Core/EnvironmentInterface.php |
| 282 | /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php |
| 283 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php |
| 284 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php |
| 285 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php |
| 286 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php |
| 287 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php |
| 288 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php |
| 289 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php |
| 290 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php |
| 291 | /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php |
| 292 | /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php |
| 293 | /vendor/symfony/contracts/Service/ResetInterface.php |
| 294 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php |
| 295 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php |
| 296 | /vendor/psr/log/Psr/Log/LoggerAwareTrait.php |
| 297 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php |
| 298 | /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php |
| 299 | /vendor/symfony/contracts/Cache/ItemInterface.php |
| 300 | /vendor/psr/cache/src/CacheItemInterface.php |
| 301 | /vendor/psr/cache/src/CacheItemPoolInterface.php |
| 302 | /vendor/symfony/contracts/Cache/CacheInterface.php |
| 303 | /vendor/psr/log/Psr/Log/LoggerAwareInterface.php |
| 304 | /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php |
| 305 | /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php |
| 306 | /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php |
| 307 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php |
| 308 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php |
| 309 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php |
| 310 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php |
| 311 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php |
| 312 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php |
| 313 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php |
| 314 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php |
| 315 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php |
| 316 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php |
| 317 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php |
| 318 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php |
| 319 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php |
| 320 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php |
| 321 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php |
| 322 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php |
| 323 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php |
| 324 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php |
| 325 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php |
| 326 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php |
| 327 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php |
| 328 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php |
| 329 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php |
| 330 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php |
| 331 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php |
| 332 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php |
| 333 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php |
| 334 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php |
| 335 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php |
| 336 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php |
| 337 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php |
| 338 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php |
| 339 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php |
| 340 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php |
| 341 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php |
| 342 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php |
| 343 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php |
| 344 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php |
| 345 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php |
| 346 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php |
| 347 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php |
| 348 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php |
| 349 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php |
| 350 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php |
| 351 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php |
| 352 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php |
| 353 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php |
| 354 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php |
| 355 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php |
| 356 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php |
| 357 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php |
| 358 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php |
| 359 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php |
| 360 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php |
| 361 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php |
| 362 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php |
| 363 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php |
| 364 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php |
| 365 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php |
| 366 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php |
| 367 | /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php |
| 368 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php |
| 369 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php |
| 370 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php |
| 371 | /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php |
| 372 | /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php |
| 373 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php |
| 374 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/DirectoryResource.php |
| 375 | /var/cache/dev/FrontContainer.php |
| 376 | /src/Adapter/Container/LegacyContainer.php |
| 377 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php |
| 378 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php |
| 379 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php |
| 380 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php |
| 381 | /vendor/symfony/contracts/Service/ServiceLocatorTrait.php |
| 382 | /vendor/psr/container/src/ContainerExceptionInterface.php |
| 383 | /vendor/psr/container/src/NotFoundExceptionInterface.php |
| 384 | /vendor/symfony/contracts/Service/ServiceProviderInterface.php |
| 385 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php |
| 386 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php |
| 387 | /src/Adapter/Container/LegacyContainerInterface.php |
| 388 | /modules/ps_contactinfo/vendor/autoload.php |
| 389 | /modules/ps_contactinfo/vendor/composer/autoload_real.php |
| 390 | /modules/ps_contactinfo/vendor/composer/autoload_static.php |
| 391 | /modules/ps_shoppingcart/vendor/autoload.php |
| 392 | /modules/ps_shoppingcart/vendor/composer/autoload_real.php |
| 393 | /modules/ps_shoppingcart/vendor/composer/platform_check.php |
| 394 | /modules/ps_shoppingcart/vendor/composer/autoload_static.php |
| 395 | /modules/ps_searchbar/vendor/autoload.php |
| 396 | /modules/ps_searchbar/vendor/composer/autoload_real.php |
| 397 | /modules/ps_searchbar/vendor/composer/platform_check.php |
| 398 | /modules/ps_searchbar/vendor/composer/autoload_static.php |
| 399 | /modules/ps_featuredproducts/vendor/autoload.php |
| 400 | /modules/ps_featuredproducts/vendor/composer/autoload_real.php |
| 401 | /modules/ps_featuredproducts/vendor/composer/platform_check.php |
| 402 | /modules/ps_featuredproducts/vendor/composer/autoload_static.php |
| 403 | /modules/ps_specials/vendor/autoload.php |
| 404 | /modules/ps_specials/vendor/composer/autoload_real.php |
| 405 | /modules/ps_specials/vendor/composer/platform_check.php |
| 406 | /modules/ps_specials/vendor/composer/autoload_static.php |
| 407 | /modules/ps_newproducts/vendor/autoload.php |
| 408 | /modules/ps_newproducts/vendor/composer/autoload_real.php |
| 409 | /modules/ps_newproducts/vendor/composer/platform_check.php |
| 410 | /modules/ps_newproducts/vendor/composer/autoload_static.php |
| 411 | /modules/ps_bestsellers/vendor/autoload.php |
| 412 | /modules/ps_bestsellers/vendor/composer/autoload_real.php |
| 413 | /modules/ps_bestsellers/vendor/composer/platform_check.php |
| 414 | /modules/ps_bestsellers/vendor/composer/autoload_static.php |
| 415 | /modules/ps_emailsubscription/vendor/autoload.php |
| 416 | /modules/ps_emailsubscription/vendor/composer/autoload_real.php |
| 417 | /modules/ps_emailsubscription/vendor/composer/platform_check.php |
| 418 | /modules/ps_emailsubscription/vendor/composer/autoload_static.php |
| 419 | /modules/ps_socialfollow/vendor/autoload.php |
| 420 | /modules/ps_socialfollow/vendor/composer/autoload_real.php |
| 421 | /modules/ps_socialfollow/vendor/composer/platform_check.php |
| 422 | /modules/ps_socialfollow/vendor/composer/autoload_static.php |
| 423 | /modules/productcomments/vendor/autoload.php |
| 424 | /modules/productcomments/vendor/composer/autoload_real.php |
| 425 | /modules/productcomments/vendor/composer/platform_check.php |
| 426 | /modules/productcomments/vendor/composer/autoload_static.php |
| 427 | /modules/ps_categorytree/vendor/autoload.php |
| 428 | /modules/ps_categorytree/vendor/composer/autoload_real.php |
| 429 | /modules/ps_categorytree/vendor/composer/autoload_static.php |
| 430 | /modules/contactform/vendor/autoload.php |
| 431 | /modules/contactform/vendor/composer/autoload_real.php |
| 432 | /modules/contactform/vendor/composer/autoload_static.php |
| 433 | /modules/dashtrends/vendor/autoload.php |
| 434 | /modules/dashtrends/vendor/composer/autoload_real.php |
| 435 | /modules/dashtrends/vendor/composer/platform_check.php |
| 436 | /modules/dashtrends/vendor/composer/autoload_static.php |
| 437 | /modules/gsitemap/vendor/autoload.php |
| 438 | /modules/gsitemap/vendor/composer/autoload_real.php |
| 439 | /modules/gsitemap/vendor/composer/platform_check.php |
| 440 | /modules/gsitemap/vendor/composer/autoload_static.php |
| 441 | /modules/statscheckup/vendor/autoload.php |
| 442 | /modules/statscheckup/vendor/composer/autoload_real.php |
| 443 | /modules/statscheckup/vendor/composer/platform_check.php |
| 444 | /modules/statscheckup/vendor/composer/autoload_static.php |
| 445 | /modules/dashproducts/vendor/autoload.php |
| 446 | /modules/dashproducts/vendor/composer/autoload_real.php |
| 447 | /modules/dashproducts/vendor/composer/platform_check.php |
| 448 | /modules/dashproducts/vendor/composer/autoload_static.php |
| 449 | /modules/ps_distributionapiclient/vendor/autoload.php |
| 450 | /modules/ps_distributionapiclient/vendor/composer/autoload_real.php |
| 451 | /modules/ps_distributionapiclient/vendor/composer/platform_check.php |
| 452 | /modules/ps_distributionapiclient/vendor/composer/autoload_static.php |
| 453 | /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php |
| 454 | /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php |
| 455 | /modules/ps_emailalerts/vendor/autoload.php |
| 456 | /modules/ps_emailalerts/vendor/composer/autoload_real.php |
| 457 | /modules/ps_emailalerts/vendor/composer/autoload_static.php |
| 458 | /modules/statsproduct/vendor/autoload.php |
| 459 | /modules/statsproduct/vendor/composer/autoload_real.php |
| 460 | /modules/statsproduct/vendor/composer/platform_check.php |
| 461 | /modules/statsproduct/vendor/composer/autoload_static.php |
| 462 | /modules/ps_viewedproduct/vendor/autoload.php |
| 463 | /modules/ps_viewedproduct/vendor/composer/autoload_real.php |
| 464 | /modules/ps_viewedproduct/vendor/composer/platform_check.php |
| 465 | /modules/ps_viewedproduct/vendor/composer/autoload_static.php |
| 466 | /modules/dashactivity/vendor/autoload.php |
| 467 | /modules/dashactivity/vendor/composer/autoload_real.php |
| 468 | /modules/dashactivity/vendor/composer/platform_check.php |
| 469 | /modules/dashactivity/vendor/composer/autoload_static.php |
| 470 | /modules/ps_googleanalytics/vendor/autoload.php |
| 471 | /modules/ps_googleanalytics/vendor/composer/autoload_real.php |
| 472 | /modules/ps_googleanalytics/vendor/composer/platform_check.php |
| 473 | /modules/ps_googleanalytics/vendor/composer/autoload_static.php |
| 474 | /modules/statsdata/vendor/autoload.php |
| 475 | /modules/statsdata/vendor/composer/autoload_real.php |
| 476 | /modules/statsdata/vendor/composer/autoload_static.php |
| 477 | /modules/ps_crossselling/vendor/autoload.php |
| 478 | /modules/ps_crossselling/vendor/composer/autoload_real.php |
| 479 | /modules/ps_crossselling/vendor/composer/platform_check.php |
| 480 | /modules/ps_crossselling/vendor/composer/autoload_static.php |
| 481 | /modules/ps_themecusto/vendor/autoload.php |
| 482 | /modules/ps_themecusto/vendor/composer/autoload_real.php |
| 483 | /modules/ps_themecusto/vendor/composer/autoload_static.php |
| 484 | /modules/statscatalog/vendor/autoload.php |
| 485 | /modules/statscatalog/vendor/composer/autoload_real.php |
| 486 | /modules/statscatalog/vendor/composer/platform_check.php |
| 487 | /modules/statscatalog/vendor/composer/autoload_static.php |
| 488 | /modules/pagesnotfound/vendor/autoload.php |
| 489 | /modules/pagesnotfound/vendor/composer/autoload_real.php |
| 490 | /modules/pagesnotfound/vendor/composer/platform_check.php |
| 491 | /modules/pagesnotfound/vendor/composer/autoload_static.php |
| 492 | /modules/autoupgrade/vendor/autoload.php |
| 493 | /modules/autoupgrade/vendor/composer/autoload_real.php |
| 494 | /modules/autoupgrade/vendor/composer/autoload_static.php |
| 495 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php |
| 496 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php |
| 497 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php |
| 498 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php |
| 499 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php |
| 500 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php |
| 501 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php |
| 502 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php |
| 503 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php |
| 504 | /modules/ph_simpleblog/vendor/autoload.php |
| 505 | /modules/ph_simpleblog/vendor/composer/autoload_real.php |
| 506 | /modules/ph_simpleblog/vendor/composer/platform_check.php |
| 507 | /modules/ph_simpleblog/vendor/composer/autoload_static.php |
| 508 | /modules/iqitsociallogin/vendor/autoload.php |
| 509 | /modules/iqitsociallogin/vendor/composer/autoload_real.php |
| 510 | /modules/iqitsociallogin/vendor/composer/platform_check.php |
| 511 | /modules/iqitsociallogin/vendor/composer/autoload_static.php |
| 512 | /modules/stripe_official/vendor/autoload.php |
| 513 | /modules/stripe_official/vendor/composer/autoload_real.php |
| 514 | /modules/stripe_official/vendor/composer/platform_check.php |
| 515 | /modules/stripe_official/vendor/composer/autoload_static.php |
| 516 | /modules/ps_eventbus/vendor/autoload.php |
| 517 | /modules/ps_eventbus/vendor/composer/autoload_real.php |
| 518 | /modules/ps_eventbus/vendor/composer/autoload_static.php |
| 519 | /modules/ps_mbo/vendor/autoload.php |
| 520 | /modules/ps_mbo/vendor/composer/autoload_real.php |
| 521 | /modules/ps_mbo/vendor/composer/platform_check.php |
| 522 | /modules/ps_mbo/vendor/composer/autoload_static.php |
| 523 | /modules/ps_mbo/vendor/clue/stream-filter/src/functions_include.php |
| 524 | /modules/ps_mbo/vendor/clue/stream-filter/src/functions.php |
| 525 | /modules/ps_mbo/vendor/php-http/message/src/filters.php |
| 526 | /modules/ps_mbo/vendor/sentry/sentry/src/functions.php |
| 527 | /modules/ps_mbo/bootstrap.php |
| 528 | /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php |
| 529 | /modules/ps_accounts/vendor/autoload.php |
| 530 | /modules/ps_accounts/vendor/composer/autoload_real.php |
| 531 | /modules/ps_accounts/vendor/composer/platform_check.php |
| 532 | /modules/ps_accounts/vendor/composer/autoload_static.php |
| 533 | /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php |
| 534 | /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php |
| 535 | /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php |
| 536 | /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php |
| 537 | /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php |
| 538 | /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php |
| 539 | /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php |
| 540 | /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php |
| 541 | /src/Core/Hook/HookModuleFilter.php |
| 542 | /src/Core/Hook/HookModuleFilterInterface.php |
| 543 | /modules/ph_simpleblog/ph_simpleblog.php |
| 544 | /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php |
| 545 | /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php |
| 546 | /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php |
| 547 | /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php |
| 548 | /modules/ph_simpleblog/models/SimpleBlogCategory.php |
| 549 | /modules/ph_simpleblog/models/SimpleBlogPost.php |
| 550 | /modules/ph_simpleblog/models/SimpleBlogPostType.php |
| 551 | /modules/ph_simpleblog/models/SimpleBlogPostImage.php |
| 552 | /modules/ph_simpleblog/models/SimpleBlogTag.php |
| 553 | /modules/ph_simpleblog/models/SimpleBlogComment.php |
| 554 | /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php |
| 555 | /modules/ph_simpleblog/classes/SimpleBlogHelper.php |
| 556 | /modules/ph_simpleblog/classes/BlogPostsFinder.php |
| 557 | /modules/ph_simpleblog/controllers/front/default_list.php |
| 558 | /classes/controller/ModuleFrontController.php |
| 559 | /override/classes/controller/FrontController.php |
| 560 | /classes/controller/FrontController.php |
| 561 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php |
| 562 | /vendor/smarty/smarty/libs/sysplugins/smarty_data.php |
| 563 | /classes/Translate.php |
| 564 | /src/PrestaShopBundle/Translation/TranslatorComponent.php |
| 565 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php |
| 566 | /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php |
| 567 | /vendor/symfony/contracts/Translation/LocaleAwareInterface.php |
| 568 | /vendor/symfony/contracts/Translation/TranslatorInterface.php |
| 569 | /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php |
| 570 | /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php |
| 571 | /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php |
| 572 | /src/PrestaShopBundle/Translation/TranslatorInterface.php |
| 573 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php |
| 574 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php |
| 575 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php |
| 576 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php |
| 577 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php |
| 578 | /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php |
| 579 | /vendor/symfony/contracts/Translation/TranslatorTrait.php |
| 580 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php |
| 581 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php |
| 582 | /var/cache/dev/translations/catalogue.pt-PT.NXhscRe.php |
| 583 | /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php |
| 584 | /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php |
| 585 | /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php |
| 586 | /modules/revi/revi.php |
| 587 | /modules/revi/models/reviCurlModel.php |
| 588 | /modules/revi/models/reviDatabaseModel.php |
| 589 | /modules/revi/models/reviGeneralModel.php |
| 590 | /modules/revi/models/reviOrdersModel.php |
| 591 | /modules/revi/models/reviProductsModel.php |
| 592 | /modules/revi/translations/pt.php |
| 593 | /modules/cookiesplus/cookiesplus.php |
| 594 | /modules/cookiesplus/classes/CookiesPlusIdnovateValidation.php |
| 595 | /modules/cookiesplus/classes/CookiesPlusCookie.php |
| 596 | /modules/cookiesplus/classes/CookiesPlusFinality.php |
| 597 | /modules/cookiesplus/classes/CookiesPlusUserConsent.php |
| 598 | /modules/cookiesplus/classes/HTMLTemplateCookiesPlusModule.php |
| 599 | /classes/pdf/HTMLTemplate.php |
| 600 | /modules/cookiesplus/translations/pt.php |
| 601 | /modules/ets_superspeed/ets_superspeed.php |
| 602 | /modules/ets_superspeed/classes/cache.php |
| 603 | /modules/ets_superspeed/classes/http_build_url.php |
| 604 | /modules/ets_superspeed/classes/ets_superspeed_defines.php |
| 605 | /modules/ets_superspeed/classes/ets_superspeed_cache_page.php |
| 606 | /modules/ets_superspeed/classes/ets_superspeed_cache_page_error.php |
| 607 | /modules/ets_superspeed/classes/ets_superspeed_cache_page_log.php |
| 608 | /modules/ets_superspeed/classes/ets_superspeed_pagination_class.php |
| 609 | /modules/ets_superspeed/classes/ets_superspeed_compressor_image.php |
| 610 | /modules/ets_superspeed/classes/ets_superspeed_upload_image.php |
| 611 | /modules/ets_superspeed/classes/ets_superspeed_browse_image.php |
| 612 | /modules/ets_superspeed/translations/pt.php |
| 613 | /modules/ps_mbo/ps_mbo.php |
| 614 | /modules/ps_mbo/src/Traits/HaveTabs.php |
| 615 | /modules/ps_mbo/src/Traits/UseHooks.php |
| 616 | /modules/ps_mbo/src/Traits/Hooks/UseDisplayBackOfficeEmployeeMenu.php |
| 617 | /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneOne.php |
| 618 | /modules/ps_mbo/src/Traits/HaveCdcComponent.php |
| 619 | /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneTwo.php |
| 620 | /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneThree.php |
| 621 | /modules/ps_mbo/src/Traits/Hooks/UseDisplayAdminThemesListAfter.php |
| 622 | /modules/ps_mbo/src/Traits/Hooks/UseDisplayDashboardTop.php |
| 623 | /modules/ps_mbo/src/Traits/Hooks/UseActionAdminControllerSetMedia.php |
| 624 | /modules/ps_mbo/src/Traits/Hooks/UseActionBeforeInstallModule.php |
| 625 | /modules/ps_mbo/src/Traits/Hooks/UseActionGetAdminToolbarButtons.php |
| 626 | /modules/ps_mbo/src/Traits/Hooks/UseActionGetAlternativeSearchPanels.php |
| 627 | /modules/ps_mbo/src/Traits/Hooks/UseDisplayAdminAfterHeader.php |
| 628 | /modules/ps_mbo/src/Traits/Hooks/UseDisplayModuleConfigureExtraButtons.php |
| 629 | /modules/ps_mbo/src/Traits/Hooks/UseActionListModules.php |
| 630 | /modules/ps_mbo/src/Traits/Hooks/UseActionModuleRegisterHookAfter.php |
| 631 | /modules/ps_mbo/src/Traits/Hooks/UseDisplayEmptyModuleCategoryExtraMessage.php |
| 632 | /modules/ps_mbo/src/Traits/Hooks/UseActionDispatcherBefore.php |
| 633 | /modules/ps_mbo/src/Traits/Hooks/UseActionObjectShopUrlUpdateAfter.php |
| 634 | /modules/ps_mbo/src/Traits/Hooks/UseActionGeneralPageSave.php |
| 635 | /modules/ps_mbo/src/Traits/Hooks/UseActionBeforeUpgradeModule.php |
| 636 | /modules/ps_mbo/src/Traits/Hooks/UseActionObjectEmployeeDeleteBefore.php |
| 637 | /modules/ps_mbo/src/Traits/Hooks/UseActionObjectEmployeeUpdateBefore.php |
| 638 | /modules/ps_mbo/src/Traits/HaveShopOnExternalService.php |
| 639 | /modules/ps_mbo/src/Tab/TabInterface.php |
| 640 | /src/PrestaShopBundle/Translation/DomainNormalizer.php |
| 641 | /src/Adapter/Localization/LegacyTranslator.php |
| 642 | /modules/ps_distributionapiclient/vendor/symfony/string/UnicodeString.php |
| 643 | /modules/ps_distributionapiclient/vendor/symfony/string/AbstractUnicodeString.php |
| 644 | /modules/ps_distributionapiclient/vendor/symfony/string/AbstractString.php |
| 645 | /controllers/front/listing/ManufacturerController.php |
| 646 | /classes/controller/ProductListingFrontController.php |
| 647 | /classes/controller/ProductPresentingFrontController.php |
| 648 | /src/Adapter/Presenter/Object/ObjectPresenter.php |
| 649 | /src/Adapter/Presenter/PresenterInterface.php |
| 650 | /src/Adapter/Presenter/Cart/CartPresenter.php |
| 651 | /src/Adapter/Image/ImageRetriever.php |
| 652 | /classes/tax/TaxConfiguration.php |
| 653 | /classes/Smarty/TemplateFinder.php |
| 654 | /classes/assets/StylesheetManager.php |
| 655 | /classes/assets/AbstractAssetManager.php |
| 656 | /src/Adapter/Assets/AssetUrlGeneratorTrait.php |
| 657 | /classes/assets/JavascriptManager.php |
| 658 | /classes/assets/CccReducer.php |
| 659 | /modules/iqitthemeeditor/iqitthemeeditor.php |
| 660 | /modules/iqitthemeeditor/src/IqitSmartyModifiers.php |
| 661 | /classes/Manufacturer.php |
| 662 | /src/Core/Util/String/StringModifier.php |
| 663 | /src/Core/Util/String/StringModifierInterface.php |
| 664 | /src/Core/Localization/Locale/Repository.php |
| 665 | /src/Core/Localization/Locale/RepositoryInterface.php |
| 666 | /src/Core/Localization/CLDR/LocaleRepository.php |
| 667 | /src/Core/Localization/CLDR/LocaleDataSource.php |
| 668 | /src/Core/Localization/CLDR/DataLayer/LocaleCache.php |
| 669 | /src/Core/Data/Layer/AbstractDataLayer.php |
| 670 | /src/Core/Localization/CLDR/LocaleDataLayerInterface.php |
| 671 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php |
| 672 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php |
| 673 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php |
| 674 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php |
| 675 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php |
| 676 | /vendor/symfony/contracts/Cache/CacheTrait.php |
| 677 | /vendor/psr/cache/src/InvalidArgumentException.php |
| 678 | /vendor/psr/cache/src/CacheException.php |
| 679 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php |
| 680 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php |
| 681 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php |
| 682 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php |
| 683 | /src/Core/Localization/CLDR/DataLayer/LocaleReference.php |
| 684 | /src/Core/Localization/CLDR/Reader.php |
| 685 | /src/Core/Localization/CLDR/ReaderInterface.php |
| 686 | /src/Core/Localization/Currency/Repository.php |
| 687 | /src/Core/Localization/Currency/RepositoryInterface.php |
| 688 | /src/Core/Localization/Currency/CurrencyDataSource.php |
| 689 | /src/Core/Localization/Currency/DataSourceInterface.php |
| 690 | /src/Core/Localization/Currency/DataLayer/CurrencyCache.php |
| 691 | /src/Core/Localization/Currency/CurrencyDataLayerInterface.php |
| 692 | /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php |
| 693 | /src/Adapter/Currency/CurrencyDataProvider.php |
| 694 | /src/Core/Currency/CurrencyDataProviderInterface.php |
| 695 | /src/Adapter/LegacyContext.php |
| 696 | /src/Adapter/Tools.php |
| 697 | /src/Core/Localization/Currency/DataLayer/CurrencyReference.php |
| 698 | /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php |
| 699 | /vendor/prestashop/decimal/src/Operation/Rounding.php |
| 700 | /src/Core/Localization/Locale.php |
| 701 | /src/Core/Localization/LocaleInterface.php |
| 702 | /src/Core/Localization/Specification/Price.php |
| 703 | /src/Core/Localization/Specification/Number.php |
| 704 | /src/Core/Localization/Specification/NumberInterface.php |
| 705 | /src/Core/Localization/Specification/Factory.php |
| 706 | /src/Core/Localization/CLDR/LocaleData.php |
| 707 | /src/Core/Localization/CLDR/NumberSymbolsData.php |
| 708 | /src/Core/Localization/CLDR/CurrencyData.php |
| 709 | /src/Core/Localization/CLDR/Locale.php |
| 710 | /src/Core/Localization/CLDR/LocaleInterface.php |
| 711 | /src/Core/Localization/Specification/NumberSymbolList.php |
| 712 | /classes/Currency.php |
| 713 | /src/Core/Localization/Currency/LocalizedCurrencyId.php |
| 714 | /classes/webservice/WebserviceRequest.php |
| 715 | /src/Core/Localization/Currency/CurrencyData.php |
| 716 | /src/Core/Localization/Currency/CurrencyCollection.php |
| 717 | /src/Core/Localization/Currency.php |
| 718 | /src/Core/Localization/CurrencyInterface.php |
| 719 | /src/Core/Localization/Specification/NumberCollection.php |
| 720 | /src/Core/Localization/Number/Formatter.php |
| 721 | /classes/Cart.php |
| 722 | /src/Adapter/AddressFactory.php |
| 723 | /classes/CartRule.php |
| 724 | /override/classes/Product.php |
| 725 | /classes/Product.php |
| 726 | /src/Core/Domain/Product/ValueObject/RedirectType.php |
| 727 | /src/Core/Util/DateTime/DateTime.php |
| 728 | /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php |
| 729 | /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php |
| 730 | /src/Core/Domain/Product/ValueObject/ProductType.php |
| 731 | /src/Core/Domain/Product/ValueObject/Reference.php |
| 732 | /src/Core/Domain/Product/ValueObject/Ean13.php |
| 733 | /src/Core/Domain/Product/ValueObject/Isbn.php |
| 734 | /src/Core/Domain/Product/ValueObject/Upc.php |
| 735 | /src/Core/Domain/Product/ProductSettings.php |
| 736 | /src/Core/Domain/Shop/ValueObject/ShopId.php |
| 737 | /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php |
| 738 | /modules/ps_emailsubscription/ps_emailsubscription.php |
| 739 | /src/Core/Module/WidgetInterface.php |
| 740 | /override/classes/Media.php |
| 741 | /classes/Media.php |
| 742 | /modules/ps_socialfollow/ps_socialfollow.php |
| 743 | /modules/ps_emailalerts/ps_emailalerts.php |
| 744 | /modules/ps_emailalerts/MailAlert.php |
| 745 | /src/Adapter/Presenter/Cart/CartLazyArray.php |
| 746 | /src/Adapter/Presenter/AbstractLazyArray.php |
| 747 | /src/Adapter/Product/PriceFormatter.php |
| 748 | /src/Core/Util/Inflector.php |
| 749 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php |
| 750 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php |
| 751 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php |
| 752 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php |
| 753 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php |
| 754 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php |
| 755 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php |
| 756 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php |
| 757 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php |
| 758 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php |
| 759 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php |
| 760 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php |
| 761 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php |
| 762 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php |
| 763 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php |
| 764 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php |
| 765 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php |
| 766 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php |
| 767 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php |
| 768 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php |
| 769 | /classes/Gender.php |
| 770 | /classes/Risk.php |
| 771 | /classes/Meta.php |
| 772 | /modules/revsliderprestashop/revsliderprestashop.php |
| 773 | /modules/revsliderprestashop/rev-loader.php |
| 774 | /modules/revsliderprestashop/includes/revslider_db.class.php |
| 775 | /modules/revsliderprestashop/includes/data.class.php |
| 776 | /modules/revsliderprestashop/includes/functions.class.php |
| 777 | /modules/revsliderprestashop/includes/em-integration.class.php |
| 778 | /modules/revsliderprestashop/includes/cssparser.class.php |
| 779 | /modules/revsliderprestashop/includes/woocommerce.class.php |
| 780 | /modules/revsliderprestashop/includes/wpml.class.php |
| 781 | /modules/revsliderprestashop/includes/colorpicker.class.php |
| 782 | /modules/revsliderprestashop/includes/navigation.class.php |
| 783 | /modules/revsliderprestashop/includes/object-library.class.php |
| 784 | /modules/revsliderprestashop/admin/includes/loadbalancer.class.php |
| 785 | /modules/revsliderprestashop/admin/includes/plugin-update.class.php |
| 786 | /modules/revsliderprestashop/includes/extension.class.php |
| 787 | /modules/revsliderprestashop/includes/favorite.class.php |
| 788 | /modules/revsliderprestashop/includes/aq-resizer.class.php |
| 789 | /modules/revsliderprestashop/includes/external-sources.class.php |
| 790 | /modules/revsliderprestashop/includes/page-template.class.php |
| 791 | /modules/revsliderprestashop/includes/slider.class.php |
| 792 | /modules/revsliderprestashop/includes/slide.class.php |
| 793 | /modules/revsliderprestashop/includes/output.class.php |
| 794 | /modules/revsliderprestashop/public/revslider-front.class.php |
| 795 | /modules/revsliderprestashop/includes/backwards.php |
| 796 | /modules/revsliderprestashop/admin/includes/class-pclzip.php |
| 797 | /modules/revsliderprestashop/admin/includes/license.class.php |
| 798 | /modules/revsliderprestashop/admin/includes/addons.class.php |
| 799 | /modules/revsliderprestashop/admin/includes/template.class.php |
| 800 | /modules/revsliderprestashop/admin/includes/functions-admin.class.php |
| 801 | /modules/revsliderprestashop/admin/includes/folder.class.php |
| 802 | /modules/revsliderprestashop/admin/includes/import.class.php |
| 803 | /modules/revsliderprestashop/admin/includes/export.class.php |
| 804 | /modules/revsliderprestashop/admin/includes/export-html.class.php |
| 805 | /modules/revsliderprestashop/admin/includes/newsletter.class.php |
| 806 | /modules/revsliderprestashop/admin/revslider-admin.class.php |
| 807 | /modules/revsliderprestashop/includes/update.class.php |
| 808 | /modules/revsliderprestashop/includes/resize-imag.php |
| 809 | /classes/Address.php |
| 810 | /classes/ImageType.php |
| 811 | /classes/State.php |
| 812 | /src/Core/Security/PasswordPolicyConfiguration.php |
| 813 | /src/Core/Configuration/DataConfigurationInterface.php |
| 814 | /src/Core/Filter/FrontEndObject/MainFilter.php |
| 815 | /src/Core/Filter/FilterInterface.php |
| 816 | /src/Core/Filter/FrontEndObject/CartFilter.php |
| 817 | /src/Core/Filter/HashMapWhitelistFilter.php |
| 818 | /src/Core/Filter/CollectionFilter.php |
| 819 | /src/Core/Filter/FrontEndObject/ProductFilter.php |
| 820 | /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php |
| 821 | /src/Core/Filter/FrontEndObject/CustomerFilter.php |
| 822 | /src/Core/Filter/FrontEndObject/ShopFilter.php |
| 823 | /src/Core/Filter/FrontEndObject/ConfigurationFilter.php |
| 824 | /classes/Smarty/SmartyDevTemplate.php |
| 825 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php |
| 826 | /var/cache/dev/smarty/compile/warehousechild/b0/93/d8/b093d8f024003febaa6744c96726b8f61c0004cc_2.file.javascript.tpl.php |
| 827 | /vendor/smarty/smarty/libs/plugins/modifier.escape.php |
| 828 | /modules/ps_shoppingcart/ps_shoppingcart.php |
| 829 | /modules/ps_searchbar/ps_searchbar.php |
| 830 | /modules/productcomments/productcomments.php |
| 831 | /modules/ps_googleanalytics/ps_googleanalytics.php |
| 832 | /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php |
| 833 | /modules/ps_googleanalytics/classes/Hook/HookInterface.php |
| 834 | /modules/iqitcontactpage/iqitcontactpage.php |
| 835 | /modules/iqitcountdown/iqitcountdown.php |
| 836 | /modules/iqitelementor/iqitelementor.php |
| 837 | /modules/iqitelementor/src/IqitElementorLanding.php |
| 838 | /modules/iqitelementor/src/IqitElementorTemplate.php |
| 839 | /modules/iqitelementor/src/IqitElementorProduct.php |
| 840 | /modules/iqitelementor/src/IqitElementorCategory.php |
| 841 | /modules/iqitelementor/src/IqitElementorContent.php |
| 842 | /modules/iqitelementor/src/iqitElementorWpHelper.php |
| 843 | /modules/iqitelementor/includes/plugin-elementor.php |
| 844 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php |
| 845 | /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php |
| 846 | /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php |
| 847 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php |
| 848 | /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php |
| 849 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php |
| 850 | /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php |
| 851 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php |
| 852 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php |
| 853 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php |
| 854 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php |
| 855 | /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php |
| 856 | /modules/iqitfreedeliverycount/iqitfreedeliverycount.php |
| 857 | /modules/iqitmegamenu/iqitmegamenu.php |
| 858 | /modules/iqitmegamenu/models/IqitMenuTab.php |
| 859 | /modules/iqitmegamenu/models/IqitMenuHtml.php |
| 860 | /modules/iqitmegamenu/models/IqitMenuLinks.php |
| 861 | /modules/iqitreviews/iqitreviews.php |
| 862 | /modules/iqitreviews/src/IqitProductReview.php |
| 863 | /modules/iqitsizecharts/iqitsizecharts.php |
| 864 | /modules/iqitsizecharts/src/IqitSizeCharts.php |
| 865 | /modules/iqitwishlist/iqitwishlist.php |
| 866 | /modules/iqitwishlist/src/IqitWishlistProduct.php |
| 867 | /modules/iqitextendedproduct/iqitextendedproduct.php |
| 868 | /modules/iqitextendedproduct/src/IqitThreeSixty.php |
| 869 | /modules/iqitextendedproduct/src/IqitProductVideo.php |
| 870 | /classes/assets/PrestashopAssetsLibraries.php |
| 871 | /modules/iqitsociallogin/iqitsociallogin.php |
| 872 | /modules/stripe_official/stripe_official.php |
| 873 | /classes/PaymentModule.php |
| 874 | /modules/stripe_official/vendor/stripe/stripe-php/lib/Event.php |
| 875 | /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiResource.php |
| 876 | /modules/stripe_official/vendor/stripe/stripe-php/lib/StripeObject.php |
| 877 | /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/Request.php |
| 878 | /modules/stripe_official/classes/services/PrestashopTranslationService.php |
| 879 | /modules/stripe_official/smarty/plugins/modifier.stripelreplace.php |
| 880 | /modules/stripe_official/vendor/stripe/stripe-php/lib/Stripe.php |
| 881 | /modules/stripe_official/vendor/stripe/stripe-php/lib/Util/ApiVersion.php |
| 882 | /modules/stripe_official/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php |
| 883 | /modules/stripe_official/classes/services/StripeDisplayHeaderService.php |
| 884 | /modules/amazzingfilter/amazzingfilter.php |
| 885 | /var/cache/dev/smarty/compile/68/9b/b5/689bb5cbdef4dccf7dcdc394ff286e6a120be41c_2.file.cookies-style.tpl.php |
| 886 | /vendor/mrclay/minify/lib/Minify/CSSmin.php |
| 887 | /vendor/tubalmartin/cssmin/src/Minifier.php |
| 888 | /vendor/tubalmartin/cssmin/src/Colors.php |
| 889 | /vendor/tubalmartin/cssmin/src/Utils.php |
| 890 | /modules/cdc_googletagmanager/cdc_googletagmanager.php |
| 891 | /modules/cdc_googletagmanager/classes/CdcGtmOrderLog.php |
| 892 | /modules/cdc_googletagmanager/classes/CdcGtmDataLayer.php |
| 893 | /modules/cdc_googletagmanager/services/CdcTools.php |
| 894 | /modules/cdc_googletagmanager/services/PrestashopUtils.php |
| 895 | /modules/cdc_googletagmanager/classes/DataLayer.php |
| 896 | /modules/cdc_googletagmanager/classes/AbstractDataLayerObject.php |
| 897 | /modules/cdc_googletagmanager/classes/gtm/Ecommerce.php |
| 898 | /modules/cdc_googletagmanager/classes/gtm/Refund.php |
| 899 | /modules/cdc_googletagmanager/classes/gtm/GoogleTagParams.php |
| 900 | /modules/cdc_googletagmanager/classes/gtm/DataLayerItem.php |
| 901 | /modules/cdc_googletagmanager/services/Gtm_Product.php |
| 902 | /src/Core/Product/Search/ProductSearchContext.php |
| 903 | /src/Core/Product/Search/ProductSearchQuery.php |
| 904 | /src/Core/Product/Search/SortOrder.php |
| 905 | /src/Adapter/Manufacturer/ManufacturerProductSearchProvider.php |
| 906 | /src/Core/Product/Search/ProductSearchProviderInterface.php |
| 907 | /src/Core/Product/Search/SortOrderFactory.php |
| 908 | /classes/Combination.php |
| 909 | /classes/stock/StockAvailable.php |
| 910 | /classes/tax/Tax.php |
| 911 | /classes/Category.php |
| 912 | /vendor/prestashop/decimal/src/DecimalNumber.php |
| 913 | /vendor/prestashop/decimal/src/Builder.php |
| 914 | /classes/SpecificPrice.php |
| 915 | /classes/tax/TaxManagerFactory.php |
| 916 | /classes/tax/TaxRulesTaxManager.php |
| 917 | /classes/tax/TaxManagerInterface.php |
| 918 | /classes/tax/TaxCalculator.php |
| 919 | /classes/GroupReduction.php |
| 920 | /src/Core/Localization/CLDR/ComputingPrecision.php |
| 921 | /src/Core/Localization/CLDR/ComputingPrecisionInterface.php |
| 922 | /classes/Pack.php |
| 923 | /override/classes/order/Order.php |
| 924 | /classes/order/Order.php |
| 925 | /classes/Feature.php |
| 926 | /src/Core/Product/Search/ProductSearchResult.php |
| 927 | /src/Core/Product/Search/SortOrdersCollection.php |
| 928 | /classes/ProductAssembler.php |
| 929 | /classes/ProductPresenterFactory.php |
| 930 | /src/Adapter/Presenter/Product/ProductListingPresenter.php |
| 931 | /src/Adapter/Presenter/Product/ProductPresenter.php |
| 932 | /src/Adapter/Product/ProductColorsRetriever.php |
| 933 | /src/Adapter/HookManager.php |
| 934 | /src/Core/Product/ProductPresentationSettings.php |
| 935 | /src/Adapter/Presenter/Product/ProductListingLazyArray.php |
| 936 | /src/Adapter/Presenter/Product/ProductLazyArray.php |
| 937 | /classes/Image.php |
| 938 | /src/Core/Image/ImageFormatConfiguration.php |
| 939 | /src/Core/Image/ImageFormatConfigurationInterface.php |
| 940 | /classes/FeatureFlag.php |
| 941 | /src/Core/FeatureFlag/FeatureFlagSettings.php |
| 942 | /src/Core/Product/Search/Pagination.php |
| 943 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/43/33/db/4333db65a99cb8dea7b76e67ee973e8ec71bdb6a_2.file.manufacturer.tpl.php |
| 944 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php |
| 945 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php |
| 946 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/4a/48/82/4a4882e58aed78292ca2808a5fe128201511b1e9_2.file.product-list.tpl.php |
| 947 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/e0/39/b4/e039b42ff27c5d3a07a262f4d116d5f7160c74b4_2.file.layout-full-width.tpl.php |
| 948 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/94/75/81/94758107a6e43d5e4d01e8ea7e6167c642b71309_2.file.layout-both-columns.tpl.php |
| 949 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/d5/96/e7/d596e738d6de2c69e8257b83795fdd763a093e7b_2.file.helpers.tpl.php |
| 950 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php |
| 951 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/93/a1/ab/93a1ab10086f321bf5d8244d2d2ff5646278ef7c_2.file.head.tpl.php |
| 952 | /var/cache/dev/smarty/compile/warehousechild/dd/1a/9a/dd1a9abb04c3d0628416f7eb64eb8e530b7b36c5_2.file.gtm_tag.tpl.php |
| 953 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php |
| 954 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/74/26/fa/7426fad222e0ff595907a1f416c7cda87fb079df_2.file.head-jsonld.tpl.php |
| 955 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/cd/d6/50/cdd65060722b35d774bfd8f64ca14d5f54982222_2.file.product-list-jsonld.tpl.php |
| 956 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/bc/ef/e4/bcefe4f6b90e9f3dd0c8a032ed7456dd0c016dff_2.file.pagination-seo.tpl.php |
| 957 | /vendor/smarty/smarty/libs/plugins/modifier.replace.php |
| 958 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/b9/bc/8c/b9bc8c1f24a08681a74b7ba4690a065439322a79_2.file.stylesheets.tpl.php |
| 959 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/61/ed/5e/61ed5e8c2077f2a73d8dec23aa9cc524a47d4ba3_2.file.javascript.tpl.php |
| 960 | /vendor/smarty/smarty/libs/plugins/modifier.count.php |
| 961 | /classes/ProductDownload.php |
| 962 | /src/Core/Cart/Calculator.php |
| 963 | /src/Core/Cart/CartRowCollection.php |
| 964 | /src/Core/Cart/Fees.php |
| 965 | /src/Core/Cart/AmountImmutable.php |
| 966 | /src/Core/Cart/CartRuleCollection.php |
| 967 | /src/Core/Cart/CartRuleCalculator.php |
| 968 | /src/Adapter/Product/PriceCalculator.php |
| 969 | /src/Core/Cart/CartRow.php |
| 970 | /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php |
| 971 | /var/cache/dev/smarty/compile/warehousechild/1c/9a/46/1c9a4697329e119d7086c82e9f4994c9be0136fd_2.file.gtm_tag_noscript.tpl.php |
| 972 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/c8/68/78/c868788d362a8b39b0e56af8a745b12c6181cd21_2.file.product-activation.tpl.php |
| 973 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f4/e0/d5/f4e0d5aca1ed5e880eca48a26832319b0724cadd_2.file.header.tpl.php |
| 974 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php |
| 975 | /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php |
| 976 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php |
| 977 | /modules/iqitlinksmanager/iqitlinksmanager.php |
| 978 | /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php |
| 979 | /modules/iqitlinksmanager/src/IqitLinkBlock.php |
| 980 | /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php |
| 981 | /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/2/6/displayNav1/warehousechild/c0/ae/af/c0aeaf5a950b603ec36ab4610b068df5b649df12.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php |
| 982 | /modules/iqithtmlandbanners/iqithtmlandbanners.php |
| 983 | /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php |
| 984 | /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php |
| 985 | /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php |
| 986 | /var/cache/dev/smarty/cache/iqithtmlandbanners/1/1/1/2/6/displayNav1/warehousechild/ca/1d/80/ca1d80baf9138fa9cc4eda09250bf00fe00c02fe.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php |
| 987 | /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/2/6/displayNav2/warehousechild/c0/ae/af/c0aeaf5a950b603ec36ab4610b068df5b649df12.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php |
| 988 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/14/27/fa/1427fa07cb611faa86a9222637cda772ec777719_2.file.header-2.tpl.php |
| 989 | /modules/iqitsearch/iqitsearch.php |
| 990 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php |
| 991 | /var/cache/dev/smarty/compile/warehousechild/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php |
| 992 | /var/cache/dev/smarty/compile/warehousechild/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php |
| 993 | /modules/ps_customersignin/ps_customersignin.php |
| 994 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php |
| 995 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php |
| 996 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php |
| 997 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php |
| 998 | /var/cache/dev/smarty/cache/iqitmegamenu/index/1/1/1/2/6/warehousechild/f4/58/0c/f4580cf5d5c8e19c51b1a69b733f19dc8c3d2ac2.iqitmegamenuviewstemplateshookhorizontal.tpl.php |
| 999 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/78/d3/1e/78d31e916333cb2382dc26e364b446e6d6e83212_2.file.mobile-header-1.tpl.php |
| 1000 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php |
| 1001 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php |
| 1002 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php |
| 1003 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/18/46/71/18467185afd8b3a6c462553741fe675b4f133a87_2.file.breadcrumb.tpl.php |
| 1004 | /modules/iqitproductsnav/iqitproductsnav.php |
| 1005 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/59/14/f9/5914f956796e473f256c316ba7e9cc367a98592b_2.file.notifications.tpl.php |
| 1006 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/2e/ee/7a/2eee7a408b05b18ec69f779564867595ac81a5a1_2.file.products-top.tpl.php |
| 1007 | /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php |
| 1008 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/ec/24/aa/ec24aa773bcd32e8ec50463fc32a811e336ab35d_2.file.sort-orders.tpl.php |
| 1009 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/22/42/02/2242027193b2cd78991b3d9ba86b18e64b87141d_2.file.pagination.tpl.php |
| 1010 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/1e/f9/93/1ef993afeebbc256d1dd15c4646dc80210333282_2.file.products.tpl.php |
| 1011 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/85/a1/29/85a129f294be2f92a60a8caf57d40e95e2f10c0d_2.file.product.tpl.php |
| 1012 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/3c/1e/b6/3c1eb67493fa59b06775e6fa34a4ff8d0176fd94_2.file.product-miniature-1.tpl.php |
| 1013 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/b6/41/c1/b641c13f2918eecadff7cbec8814851994efd7bd_2.file.product-miniature-thumb.tpl.php |
| 1014 | /var/cache/dev/smarty/compile/warehousechild/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php |
| 1015 | /src/Adapter/ContainerFinder.php |
| 1016 | /modules/productcomments/src/Repository/ProductCommentRepository.php |
| 1017 | /vendor/doctrine/doctrine-bundle/Repository/ServiceEntityRepository.php |
| 1018 | /vendor/doctrine/orm/lib/Doctrine/ORM/EntityRepository.php |
| 1019 | /vendor/doctrine/persistence/src/Persistence/ObjectRepository.php |
| 1020 | /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php |
| 1021 | /vendor/doctrine/doctrine-bundle/Repository/ServiceEntityRepositoryInterface.php |
| 1022 | /vendor/doctrine/doctrine-bundle/Registry.php |
| 1023 | /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/ManagerRegistry.php |
| 1024 | /vendor/doctrine/persistence/src/Persistence/AbstractManagerRegistry.php |
| 1025 | /vendor/doctrine/persistence/src/Persistence/ManagerRegistry.php |
| 1026 | /vendor/doctrine/persistence/src/Persistence/ConnectionRegistry.php |
| 1027 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/LoggerChain.php |
| 1028 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/SQLLogger.php |
| 1029 | /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/Logger/DbalLogger.php |
| 1030 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/DebugStack.php |
| 1031 | /vendor/doctrine/doctrine-bundle/ConnectionFactory.php |
| 1032 | /src/PrestaShopBundle/DependencyInjection/RuntimeConstEnvVarProcessor.php |
| 1033 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/EnvVarProcessorInterface.php |
| 1034 | /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/ContainerAwareEventManager.php |
| 1035 | /vendor/doctrine/event-manager/src/EventManager.php |
| 1036 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/DriverManager.php |
| 1037 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/MySQL/Driver.php |
| 1038 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOMySql/Driver.php |
| 1039 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/AbstractMySQLDriver.php |
| 1040 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver.php |
| 1041 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ExceptionConverterDriver.php |
| 1042 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/VersionAwarePlatformDriver.php |
| 1043 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Connection.php |
| 1044 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Connection.php |
| 1045 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/TransactionIsolationLevel.php |
| 1046 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/ParameterType.php |
| 1047 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/FetchMode.php |
| 1048 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Query/Expression/ExpressionBuilder.php |
| 1049 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Connection.php |
| 1050 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOConnection.php |
| 1051 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOQueryImplementation.php |
| 1052 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ServerInfoAwareConnection.php |
| 1053 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Statement.php |
| 1054 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatement.php |
| 1055 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatementImplementations.php |
| 1056 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Statement.php |
| 1057 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ResultStatement.php |
| 1058 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Result.php |
| 1059 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Events.php |
| 1060 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MariaDb1027Platform.php |
| 1061 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySqlPlatform.php |
| 1062 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/AbstractPlatform.php |
| 1063 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/DateIntervalUnit.php |
| 1064 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/TrimMode.php |
| 1065 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Types.php |
| 1066 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Type.php |
| 1067 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ArrayType.php |
| 1068 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/AsciiStringType.php |
| 1069 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/StringType.php |
| 1070 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BigIntType.php |
| 1071 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpIntegerMappingType.php |
| 1072 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BinaryType.php |
| 1073 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BlobType.php |
| 1074 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BooleanType.php |
| 1075 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateType.php |
| 1076 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateImmutableType.php |
| 1077 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateIntervalType.php |
| 1078 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeType.php |
| 1079 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpDateTimeMappingType.php |
| 1080 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeImmutableType.php |
| 1081 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzType.php |
| 1082 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzImmutableType.php |
| 1083 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DecimalType.php |
| 1084 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/FloatType.php |
| 1085 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/GuidType.php |
| 1086 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/IntegerType.php |
| 1087 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonType.php |
| 1088 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonArrayType.php |
| 1089 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ObjectType.php |
| 1090 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SimpleArrayType.php |
| 1091 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SmallIntType.php |
| 1092 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TextType.php |
| 1093 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeType.php |
| 1094 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeImmutableType.php |
| 1095 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TypeRegistry.php |
| 1096 | /modules/productcomments/src/Entity/ProductComment.php |
| 1097 | /vendor/doctrine/orm/lib/Doctrine/ORM/Proxy/Proxy.php |
| 1098 | /vendor/doctrine/common/lib/Doctrine/Common/Proxy/Proxy.php |
| 1099 | /vendor/doctrine/persistence/src/Persistence/Proxy.php |
| 1100 | /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriverChain.php |
| 1101 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/ImplicitlyIgnoredAnnotationNames.php |
| 1102 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/IgnoreAnnotation.php |
| 1103 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/PhpParser.php |
| 1104 | /src/PrestaShopBundle/Service/Database/DoctrineNamingStrategy.php |
| 1105 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UnderscoreNamingStrategy.php |
| 1106 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamingStrategy.php |
| 1107 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DefaultQuoteStrategy.php |
| 1108 | /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/SQLResultCasing.php |
| 1109 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/QuoteStrategy.php |
| 1110 | /vendor/doctrine/doctrine-bundle/Mapping/ContainerEntityListenerResolver.php |
| 1111 | /vendor/doctrine/doctrine-bundle/Mapping/EntityListenerServiceResolver.php |
| 1112 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListenerResolver.php |
| 1113 | /vendor/doctrine/doctrine-bundle/Repository/ContainerRepositoryFactory.php |
| 1114 | /vendor/doctrine/orm/lib/Doctrine/ORM/Repository/RepositoryFactory.php |
| 1115 | /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/NotSupported.php |
| 1116 | /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/ORMException.php |
| 1117 | /vendor/doctrine/orm/lib/Doctrine/ORM/ORMException.php |
| 1118 | /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManager.php |
| 1119 | /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManagerInterface.php |
| 1120 | /vendor/doctrine/persistence/src/Persistence/ObjectManager.php |
| 1121 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataFactory.php |
| 1122 | /vendor/doctrine/persistence/src/Persistence/Mapping/AbstractClassMetadataFactory.php |
| 1123 | /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadataFactory.php |
| 1124 | /vendor/doctrine/orm/lib/Doctrine/ORM/UnitOfWork.php |
| 1125 | /vendor/doctrine/persistence/src/Persistence/PropertyChangedListener.php |
| 1126 | /vendor/doctrine/orm/lib/Doctrine/ORM/Event/ListenersInvoker.php |
| 1127 | /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/IdentifierFlattener.php |
| 1128 | /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/HydrationCompleteHandler.php |
| 1129 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Reflection/ReflectionPropertiesGetter.php |
| 1130 | /vendor/doctrine/persistence/src/Persistence/Mapping/RuntimeReflectionService.php |
| 1131 | /vendor/doctrine/persistence/src/Persistence/Mapping/ReflectionService.php |
| 1132 | /vendor/doctrine/orm/lib/Doctrine/ORM/Proxy/ProxyFactory.php |
| 1133 | /vendor/doctrine/common/lib/Doctrine/Common/Proxy/AbstractProxyFactory.php |
| 1134 | /vendor/doctrine/common/lib/Doctrine/Common/Proxy/ProxyGenerator.php |
| 1135 | /vendor/doctrine/doctrine-bundle/ManagerConfigurator.php |
| 1136 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/TokenParser.php |
| 1137 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Enum.php |
| 1138 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attribute.php |
| 1139 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attributes.php |
| 1140 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/NamedArgumentConstructor.php |
| 1141 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/NamedArgumentConstructorAnnotation.php |
| 1142 | /vendor/doctrine/persistence/src/Persistence/Mapping/ProxyClassNameResolver.php |
| 1143 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadata.php |
| 1144 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataInfo.php |
| 1145 | /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadata.php |
| 1146 | /vendor/doctrine/instantiator/src/Doctrine/Instantiator/Instantiator.php |
| 1147 | /vendor/doctrine/instantiator/src/Doctrine/Instantiator/InstantiatorInterface.php |
| 1148 | /vendor/doctrine/orm/lib/Doctrine/ORM/Id/IdentityGenerator.php |
| 1149 | /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AbstractIdGenerator.php |
| 1150 | /vendor/doctrine/orm/lib/Doctrine/ORM/Events.php |
| 1151 | /vendor/doctrine/persistence/src/Persistence/Reflection/RuntimeReflectionProperty.php |
| 1152 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Query/QueryBuilder.php |
| 1153 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Query/Expression/CompositeExpression.php |
| 1154 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/Result.php |
| 1155 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverStatement.php |
| 1156 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Result.php |
| 1157 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Abstraction/Result.php |
| 1158 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverResultStatement.php |
| 1159 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/SQLParserUtils.php |
| 1160 | /var/cache/dev/smarty/compile/warehousechild/e9/e4/d0/e9e4d0b935584380ea8beb3f467908e1cd2486f5_2.module.productcommentsviewstemplateshookproductlistreviews.tpl.php |
| 1161 | /vendor/smarty/smarty/libs/plugins/function.math.php |
| 1162 | /var/cache/dev/smarty/compile/warehousechild/7d/45/fd/7d45fdb82b0bb33abbc0746db68d10285ebcdcda_2.file.product_list.tpl.php |
| 1163 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php |
| 1164 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/13/4f/d5/134fd533981b9c87276d73ad90b93f2efd2aaa8b_2.file.product-miniature-btn.tpl.php |
| 1165 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/c3/81/22/c38122a8bfcf3645e78d7ea45e241a6fab713f52_2.file.products-bottom.tpl.php |
| 1166 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/87/b6/dd/87b6ddc26dd1a6f36ea818ff35c6abea1aa48a29_2.file.footer.tpl.php |
| 1167 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/ba/e3/09/bae3097063c1cad744747b74396ce793862147d4_2.file.footer-3.tpl.php |
| 1168 | /var/cache/dev/smarty/cache/iqithtmlandbanners/1/1/1/2/6/displayFooter/warehousechild/ca/1d/80/ca1d80baf9138fa9cc4eda09250bf00fe00c02fe.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php |
| 1169 | /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/2/6/displayFooter/warehousechild/c0/ae/af/c0aeaf5a950b603ec36ab4610b068df5b649df12.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php |
| 1170 | /var/cache/dev/smarty/cache/iqitcontactpage/1/1/1/2/6/warehousechild/02/a0/c5/02a0c553bec0f7f36a6437ed6ee5cd094fc1bff5.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php |
| 1171 | /var/cache/dev/smarty/compile/warehousechild/5c/c7/8c/5cc78c6a0bfd552a3a2a8c444286f5b43f7a8d16_2.file.widget.tpl.php |
| 1172 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/c7/e3/80/c7e38092c3a1bca3e3d66647693b2ecaf45078e8_2.file.footer-copyrights-2.tpl.php |
| 1173 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/d3/6e/a5/d36ea56ff42202bbbd6d0746195dcfdfeade0d5f_2.file.social-links.tpl.php |
| 1174 | /var/cache/dev/smarty/compile/warehousechildlayouts_layout_full_width_tpl/53/55/0a/53550a6cb440726684c285a7503e2eabcaf68295_2.file.password-policy-template.tpl.php |
| 1175 | /classes/form/CustomerLoginForm.php |
| 1176 | /classes/form/AbstractForm.php |
| 1177 | /classes/form/FormInterface.php |
| 1178 | /src/Core/Foundation/Templating/RenderableInterface.php |
| 1179 | /classes/form/CustomerLoginFormatter.php |
| 1180 | /classes/form/FormFormatterInterface.php |
| 1181 | /classes/ValidateConstraintTranslator.php |
| 1182 | /src/Core/Util/InternationalizedDomainNameConverter.php |
| 1183 | /src/Core/Foundation/Templating/RenderableProxy.php |
| 1184 | /var/cache/dev/smarty/compile/warehousechild/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php |
| 1185 | /classes/form/FormField.php |
| 1186 | /var/cache/dev/smarty/compile/warehousechild/be/48/67/be486733d28cf8864b1c93db6521a6b91abdc413_2.file.login-form.tpl.php |
| 1187 | /var/cache/dev/smarty/compile/warehousechild/66/71/87/667187258fb38c59560ed424595abfe4b2df86b5_2.file.form-errors.tpl.php |
| 1188 | /var/cache/dev/smarty/compile/0d/0d/05/0d0d05765d9e0f89a5547c6d53787f208843a239_2.file.form-fields.tpl.php |
| 1189 | /var/cache/dev/smarty/compile/66/71/87/667187258fb38c59560ed424595abfe4b2df86b5_2.file.form-errors.tpl.php |
| 1190 | /var/cache/dev/smarty/cache/iqitsociallogin/1/1/1/2/6/warehousechild/31/46/8b/31468b6f4909260810963fa95d4ad77b138eb8af.iqitsocialloginviewstemplateshookauthentication.tpl.php |
| 1191 | /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php |
| 1192 | /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php |
| 1193 | /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php |
| 1194 | /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php |
| 1195 | /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php |
| 1196 | /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php |
| 1197 | /modules/statsdata/statsdata.php |
| 1198 | /classes/Connection.php |
| 1199 | /classes/ConnectionsSource.php |
| 1200 | /var/cache/dev/smarty/compile/warehousechild/f1/85/e0/f185e0db6281250084a05a2bf48f4e294b45e6d0_2.file.cookies-notice.tpl.php |
| 1201 | /var/cache/dev/smarty/compile/warehousechild/45/e7/4d/45e74d844af4d0f8912c3bf9ec70328c284d7974_2.file.cookies-notice-customize-button.tpl.php |
| 1202 | /var/cache/dev/smarty/compile/warehousechild/06/0c/25/060c2529011618f2b5a9f35381fbc623ca3d7e36_2.file.cookies-notice-reject-button.tpl.php |
| 1203 | /var/cache/dev/smarty/compile/warehousechild/8b/5e/6a/8b5e6a3bb6478b9138f509c621e3ec0f143c1c19_2.file.cookies-notice-accept-button.tpl.php |
| 1204 | /var/cache/dev/smarty/compile/warehousechild/d0/9f/a0/d09fa02a3c360ac084cb1782056bca2843c95afa_2.file.cookies-notice-customize-customize-button.tpl.php |
| 1205 | /var/cache/dev/smarty/compile/warehousechild/75/36/b2/7536b2f3d0e2fa25a2a703d9e1a79afc804aa6a2_2.file.cookies-notice-accept-customize-button.tpl.php |
| 1206 | /var/cache/dev/smarty/compile/72/0e/76/720e7678acff84920e1d5bfc213b25a817b3778a_2.file.gtm_consentmode.tpl.php |
| 1207 | /vendor/mrclay/jsmin-php/src/JSMin/JSMin.php |
| 1208 | /modules/ets_superspeed/classes/ext/minify_html |